You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RIOX2
Ribosomal oxygenase 2

Protein Summary
Description
Oxygenase that can act as both a histone lysine demethylase and a ribosomal histidine hydroxylase. Is involved in the demethylation of trimethylated 'Lys-9' on histone H3 (H3K9me3), leading to an increase in ribosomal RNA expression. Also catalyzes the hydroxylation of 60S ribosomal protein L27a on 'His-39'. May play an important role in cell growth and survival. May be involved in ribosome biogenesis, most likely during the assembly process of pre-ribosomal particles. MINA is a c-Myc (MYC; MIM 190080) target gene that may play a role in cell proliferation or regulation of cell growth. (Tsuneoka et al., 2002 [PubMed 12091391]; Zhang et al., 2005 [PubMed 15897898]).[supplied by OMIM, May 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000333396
  • ENSP00000328251
  • ENSG00000170854
  • ENST00000360258
  • ENSP00000353395
  • ENST00000394198
  • ENSP00000377748
  • ENST00000514314
  • ENSP00000424955

Symbol
  • MDIG
  • MINA
  • MINA53
  • NO52
  • ROX
  • MDIG
  • MINA
  • NO52
  • JMJD10
  • MINA53
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 34.06   (req: < 5)
Gene RIFs: 28   (req: <= 3)
Antibodies: 354   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 34.06   (req: >= 5)
Gene RIFs: 28   (req: > 3)
Antibodies: 354   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Protein-Protein Interactions (58)
1 – 10 of 58
RBM18
Tdark
p_int: 0.999368593
p_ni: 0.000631407
Score: 0.187
Data Source: BioPlex,STRINGDB
HIRIP3
Tdark
Novelty: 0.64900846
p_int: 0.998933528
p_ni: 0.001066421
p_wrong: 5.1e-8
Data Source: BioPlex
SURF2
Tdark
Novelty: 0.15957447
p_int: 0.99813354
p_ni: 0.00186646
Score: 0.499
Data Source: BioPlex,STRINGDB
C1orf174
Tdark
Novelty: 5
p_int: 0.995605244
p_ni: 0.004394754
p_wrong: 2e-9
Data Source: BioPlex
UIMC1
Tbio
Novelty: 0.0201143
p_int: 0.992072197
p_ni: 0.007927803
Score: 0.209
Data Source: BioPlex,STRINGDB
RPL18
Tbio
Novelty: 0.02870071
p_int: 0.984783106
p_ni: 0.015216894
Data Source: BioPlex
POLL
Tbio
Family: Enzyme
Novelty: 0.00129691
p_int: 0.970756155
p_ni: 0.029243845
Score: 0.167
Data Source: BioPlex,STRINGDB
FAM9C
Tdark
Novelty: 1.42857143
p_int: 0.968967638
p_ni: 0.03103236
p_wrong: 2e-9
Data Source: BioPlex
THAP3
Tdark
Family: TF
Novelty: 2.94736842
p_int: 0.958417695
p_ni: 0.041574256
p_wrong: 0.000008049
Data Source: BioPlex
DDX54
Tbio
Family: Enzyme
Novelty: 0.10631117
p_int: 0.936938083
p_ni: 0.063059682
p_wrong: 0.000002235
Data Source: BioPlex
Publication Statistics
PubMed Score  34.06

PubMed score by year
PubTator Score  54.89

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIKTETFFKEFWEQKPLLIQRDD
1-70
PALATYYGSLFKLTDLKSLCSRGMYYGRDVNVCRCVNGKKKVLNKDGKAHFLQLRKDFDQKRATIQFHQP
70-140
QRFKDELWRIQEKLECYFGSLVGSNVYITPAGSQGLPPHYDDVEVFILQLEGEKHWRLYHPTVPLAREYS
140-210
VEAEERIGRPVHEFMLKPGDLLYFPRGTIHQADTPAGLAHSTHVTISTYQNNSWGDFLLDTISGLVFDTA
210-280
KEDVELRTGIPRQLLLQVESTTVATRRLSGFLRTLADRLEGTKELLSSDMKKDFIMHRLPPYSAGDGAEL
280-350
STPGGKLPRLDSVVRLQFKDHIVLTVLPDQDQSDEAQEKMVYIYHSLKNSRETHMMGNEEETEFHGLRFP
350-420
LSHLDALKQIWNSPAISVKDLKLTTDEEKESLVLSLWTECLIQVV
420-465
MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIKTETFFKEFWEQKPLLIQRDDPALATYYGSLFKLTDLKSLCSRGMYYGRDVNVCRCVNGKKKVLNKDGKAHFLQLRKDFDQKRATIQFHQPQRFKDELWRIQEKLECYFGSLVGSNVYITPAGSQGLPPHYDDVEVFILQLEGEKHWRLYHPTVPLAREYSVEAEERIGRPVHEFMLKPGDLLYFPRGTIHQADTPAGLAHSTHVTISTYQNNSWGDFLLDTISGLVFDTAKEDVELRTGIPRQLLLQVESTTVATRRLSGFLRTLADRLEGTKELLSSDMKKDFIMHRLPPYSAGDGAELSTPGGKLPRLDSVVRLQFKDHIVLTVLPDQDQSDEAQEKMVYIYHSLKNSRETHMMGNEEETEFHGLRFPLSHLDALKQIWNSPAISVKDLKLTTDEEKESLVLSLWTECLIQVV