You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
IFNLR1
Interferon lambda receptor 1

Protein Summary
Description
The IFNLR1/IL10RB dimer is a receptor for the cytokine ligands IFNL2 and IFNL3 and mediates their antiviral activity. The ligand/receptor complex stimulate the activation of the JAK/STAT signaling pathway leading to the expression of IFN-stimulated genes (ISG), which contribute to the antiviral state. Determines the cell type specificity of the lambda interferon action. Shows a more restricted pattern of expression in the epithelial tissues thereby limiting responses to lambda interferons primarily to epithelial cells of the respiratory, gastrointestinal, and reproductive tracts. Seems not to be essential for early virus-activated host defense in vaginal infection, but plays an important role in Toll-like receptor (TLR)-induced antiviral defense. Plays a significant role in the antiviral immune defense in the intestinal epithelium. The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000327535
  • ENSP00000327824
  • ENSG00000185436
  • ENST00000327575
  • ENSP00000328994
  • ENST00000374418
  • ENSP00000363539
  • ENST00000374421
  • ENSP00000363542

Symbol
  • IL28RA
  • LICR2
  • IFNLR
  • LICR2
  • IL28RA
  • CRF2/12
  • IL-28R1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.77
tissue sample
0.63
transcription factor
0.59
tissue
0.56
microRNA
0.52


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 40.8   (req: < 5)
Gene RIFs: 25   (req: <= 3)
Antibodies: 220   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 40.8   (req: >= 5)
Gene RIFs: 25   (req: > 3)
Antibodies: 220   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (39)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
Interleukin-20 family signaling
Reactome
Other interleukin signaling
Reactome
Signaling by Interleukins
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
Interleukin-20 family signaling
Other interleukin signaling
Signaling by Interleukins
Protein-Protein Interactions (134)
1 – 10 of 134
JAK1
Tclin
Family: Kinase
Novelty: 0.00136831
p_int: 0.999980493
p_ni: 0.000019507
Score: 0.992
Data Source: BioPlex,Reactome,STRINGDB
BTRC
Tbio
Novelty: 0.00393331
p_int: 0.999418858
p_ni: 0.000581142
Data Source: BioPlex
DPY19L1
Tdark
Family: Enzyme
Novelty: 0.64864865
p_int: 0.999144192
p_ni: 0.000801147
p_wrong: 0.000054661
Data Source: BioPlex
TMEM183A
Tdark
Novelty: 0.70391061
p_int: 0.998887307
p_ni: 0.000659176
p_wrong: 0.000453517
Data Source: BioPlex
FAM3C
Tbio
Novelty: 0.05804701
p_int: 0.997547146
p_ni: 0.002448787
p_wrong: 0.000004067
Data Source: BioPlex
C1QL1
Tdark
Novelty: 0.19017433
p_int: 0.996111799
p_ni: 0.003882308
p_wrong: 0.000005893
Data Source: BioPlex
AURKA
Tchem
Family: Kinase
Novelty: 0.00069833
p_int: 0.993797238
p_ni: 0.006202762
Data Source: BioPlex
FBXW11
Tbio
Novelty: 0.14703388
p_int: 0.993190186
p_ni: 0.006809813
p_wrong: 1e-9
Data Source: BioPlex
TMX4
Tdark
Novelty: 0.875
p_int: 0.982471348
p_ni: 0.017528652
Data Source: BioPlex
PNPLA6
Tbio
Family: Enzyme
Novelty: 0.00194634
p_int: 0.980946792
p_ni: 0.019053208
Data Source: BioPlex
Publication Statistics
PubMed Score  40.80

PubMed score by year
PubTator Score  39.87

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAGPERWGPLLLCLLQAAPGRPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWRE
1-70
VEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILS
70-140
ANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYS
140-210
KFSKPTCFLLEVPEANWAFLVLPSLLILLLVIAAGGVIWKTLMGNPWFQRAKMPRALDFSGHTHPVATFQ
210-280
PSRPESVNDLFLCPQKELTRGVRPTPRVRAPATQQTRWKKDLAEDEEEEDEEDTEDGVSFQPYIEPPSFL
280-350
GQEHQAPGHSEAGGVDSGRPRAPLVPSEGSSAWDSSDRSWASTVDSSWDRAGSSGYLAEKGPGQGPGGDG
350-420
HQESLPPPEFSKDSGFLEELPEDNLSSWATWGTLPPEPNLVPGGPPVSLQTLTFCWESSPEEEEEARESE
420-490
IEDSDAGSWGAESTQRTEDRGRTLGHYMAR
490-520
MAGPERWGPLLLCLLQAAPGRPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEANWAFLVLPSLLILLLVIAAGGVIWKTLMGNPWFQRAKMPRALDFSGHTHPVATFQPSRPESVNDLFLCPQKELTRGVRPTPRVRAPATQQTRWKKDLAEDEEEEDEEDTEDGVSFQPYIEPPSFLGQEHQAPGHSEAGGVDSGRPRAPLVPSEGSSAWDSSDRSWASTVDSSWDRAGSSGYLAEKGPGQGPGGDGHQESLPPPEFSKDSGFLEELPEDNLSSWATWGTLPPEPNLVPGGPPVSLQTLTFCWESSPEEEEEARESEIEDSDAGSWGAESTQRTEDRGRTLGHYMAR