You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
MYLK4
Myosin light chain kinase family member 4

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000274643
  • ENSP00000274643
  • ENSG00000145949

Symbol
  • SGK085
  • SgK085
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.9
protein domain
0.85
gene perturbation
0.81
microRNA
0.79
tissue sample
0.55


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.08   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 119   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.08   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 119   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
sunitinib
chemical structure image
Active Ligands (1)
1 – 1 of 1
CHEMBL603469
chemical structure image
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (55)
Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
KEGG
Platelet activation
KEGG
Focal adhesion
KEGG
Oxytocin signaling pathway
KEGG
Gastric acid secretion
KEGG
Regulation of actin cytoskeleton
Name
Explore in Pharos
Explore in Source
Platelet activation
Focal adhesion
Oxytocin signaling pathway
Gastric acid secretion
Regulation of actin cytoskeleton
Gene Ontology Terms (2)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (60)
1 – 10 of 60
HSP90AB4P
Tdark
p_int: 0.999998551
p_ni: 0.000001449
Data Source: BioPlex
HSP90AB3P
Tdark
p_int: 0.999998226
p_ni: 0.000001773
p_wrong: 1e-9
Data Source: BioPlex
HSP90AA5P
Tdark
p_int: 0.999941458
p_ni: 0.000058539
p_wrong: 4e-9
Data Source: BioPlex
HSP90AB1
Tchem
Novelty: 0.01466977
p_int: 0.991770218
p_ni: 0.008229782
Score: 0.287
Data Source: BioPlex,STRINGDB
HSP90AA1
Tchem
Novelty: 0.00020424
p_int: 0.967610273
p_ni: 0.032389727
Score: 0.306
Data Source: BioPlex,STRINGDB
MYL12A
Tbio
Novelty: 0.01093045
Score: 0.835
Data Source: STRINGDB
MYL12B
Tbio
Novelty: 0.01158157
Score: 0.834
Data Source: STRINGDB
MYL9
Tbio
Novelty: 0.00271264
Score: 0.833
Data Source: STRINGDB
PRKCE
Tchem
Family: Kinase
Novelty: 0.01268488
Score: 0.804
Data Source: STRINGDB
MCUR1
Tbio
Novelty: 0.13099694
Score: 0.726
Data Source: STRINGDB
Publication Statistics
PubMed Score  2.08

PubMed score by year
PubTator Score  1.17

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MLKVKRLEEFNTCYNSNQLEKMAFFQCREEVEKVKCFLEKNSGDQDSRSGHNEAKEVWSNADLTERMPVK
1-70
SKRTSALAVDIPAPPAPFDHRIVTAKQGAVNSFYTVSKTEILGGGRFGQVHKCEETATGLKLAAKIIKTR
70-140
GMKDKEEVKNEISVMNQLDHANLIQLYDAFESKNDIVLVMEYVDGGELFDRIIDESYNLTELDTILFMKQ
140-210
ICEGIRHMHQMYILHLDLKPENILCVNRDAKQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYDFV
210-280
SFPTDMWSVGVIAYMLLSGLSPFLGDNDAETLNNILACRWDLEDEEFQDISEEAKEFISKLLIKEKSWRI
280-350
SASEALKHPWLSDHKLHSRLNAQKKKNRGSDAQDFVTK
350-388
MLKVKRLEEFNTCYNSNQLEKMAFFQCREEVEKVKCFLEKNSGDQDSRSGHNEAKEVWSNADLTERMPVKSKRTSALAVDIPAPPAPFDHRIVTAKQGAVNSFYTVSKTEILGGGRFGQVHKCEETATGLKLAAKIIKTRGMKDKEEVKNEISVMNQLDHANLIQLYDAFESKNDIVLVMEYVDGGELFDRIIDESYNLTELDTILFMKQICEGIRHMHQMYILHLDLKPENILCVNRDAKQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYDFVSFPTDMWSVGVIAYMLLSGLSPFLGDNDAETLNNILACRWDLEDEEFQDISEEAKEFISKLLIKEKSWRISASEALKHPWLSDHKLHSRLNAQKKKNRGSDAQDFVTK