You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
TMEM25
Transmembrane protein 25

Protein Classes
Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000313236
  • ENSP00000315635
  • ENSG00000149582
  • ENST00000354064
  • ENSP00000278959
  • ENST00000354284
  • ENSP00000346237
  • ENST00000359862
  • ENSP00000352924
  • ENST00000411589
  • ENSP00000411882
  • ENST00000442938
  • ENSP00000416071
  • ENST00000524725
  • ENSP00000431205
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.84
virus perturbation
0.83
gene perturbation
0.74
kinase perturbation
0.71
microRNA
0.69


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.77   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 58   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.77   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 58   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (3)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Protein-Protein Interactions (86)
1 – 10 of 86
CES3
Tbio
Family: Enzyme
Novelty: 0.00638802
p_int: 0.99999951
p_ni: 4.3e-7
p_wrong: 6e-8
Score: 0.157
Data Source: BioPlex,STRINGDB
HTRA3
Tbio
Family: Enzyme
Novelty: 0.10434783
p_int: 0.999999159
p_ni: 5.19e-7
p_wrong: 3.22e-7
Score: 0.243
Data Source: BioPlex,STRINGDB
HTRA1
Tbio
Family: Enzyme
Novelty: 0.00171455
p_int: 0.999947389
p_ni: 0.000052256
p_wrong: 3.56e-7
Data Source: BioPlex
PEX6
Tbio
Family: Enzyme
Novelty: 0.01134558
p_int: 0.999568211
p_ni: 0.000431619
p_wrong: 1.7e-7
Data Source: BioPlex
LARGE1
Tbio
Family: Enzyme
Novelty: 0.00901516
p_int: 0.999325701
p_ni: 0.000602168
p_wrong: 0.000072131
Data Source: BioPlex
DHFR2
Tbio
Family: Enzyme
Novelty: 0.03421403
p_int: 0.999265912
p_ni: 0.000734088
Data Source: BioPlex
NID2
Tbio
Novelty: 0.02089229
p_int: 0.998891939
p_ni: 0.001108018
p_wrong: 4.3e-8
Data Source: BioPlex
FUT11
Tdark
Family: Enzyme
Novelty: 0.54098361
p_int: 0.998688656
p_ni: 0.001311323
p_wrong: 2.1e-8
Data Source: BioPlex
GALNT18
Tbio
Family: Enzyme
Novelty: 0.16499251
p_int: 0.998374435
p_ni: 0.001625563
p_wrong: 1e-9
Score: 0.194
Data Source: BioPlex,STRINGDB
FUZ
Tbio
Novelty: 0.02632541
p_int: 0.997950151
p_ni: 0.001063864
p_wrong: 0.000985984
Data Source: BioPlex
Publication Statistics
PubMed Score  2.77

PubMed score by year
PubTator Score  2

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MALPPGPAALRHTLLLLPALLSSGWGELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQ
1-70
LQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQ
70-140
EAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVA
140-210
TNDVGVTSASLPAPGLLATRVEVPLLGIVVAAGLALGTLVGFSTLVACLVCRKEKKTKGPSRHPSLISSD
210-280
SNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSQGFIRLPVL
280-350
GYIYRVSSVSSDEIWL
350-366
MALPPGPAALRHTLLLLPALLSSGWGELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAPGLLATRVEVPLLGIVVAAGLALGTLVGFSTLVACLVCRKEKKTKGPSRHPSLISSDSNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSQGFIRLPVLGYIYRVSSVSSDEIWL