You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PLA2G4D
Cytosolic phospholipase A2 delta

Protein Summary
Description
Calcium-dependent phospholipase A2 that selectively hydrolyzes glycerophospholipids in the sn-2 position (PubMed:14709560). May have a substrate specificity for linoleic acid at the sn-2 position (PubMed:14709560). The phospholipase A2 enzyme family, including PLA2G4D, catalyze the hydrolysis of glycerophospholipids at the sn-2 position and then liberate free fatty acids and lysophospholipids (Chiba et al., 2004 [PubMed 14709560]).[supplied by OMIM, Jun 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000290472
  • ENSP00000290472
  • ENSG00000159337

Symbol
  • cPLA2delta
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
metabolite
0.78
microRNA
0.73
cell type or tissue
0.62
biological process
0.48
cellular component
0.42


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.78   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 65   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.78   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 65   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (41)
Acyl chain remodelling of PC (R-HSA-1482788)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 11
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Acyl chain remodelling of PC
Reactome
Acyl chain remodelling of PE
Reactome
Acyl chain remodelling of PG
Reactome
Acyl chain remodelling of PI
Reactome
Acyl chain remodelling of PS
Name
Explore in Pharos
Explore in Source
Acyl chain remodelling of PC
Acyl chain remodelling of PE
Acyl chain remodelling of PG
Acyl chain remodelling of PI
Acyl chain remodelling of PS
Gene Ontology Terms (19)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Protein-Protein Interactions (84)
1 – 10 of 84
PLA2G5
Tchem
Family: Enzyme
Novelty: 0.03057912
Score: 0.905
Data Source: STRINGDB
GNAQ
Tbio
Novelty: 0.00176666
Score: 0.834
Data Source: STRINGDB
GNAS
Tbio
Novelty: 0.00259764
Score: 0.83
Data Source: STRINGDB
GNAS
Tbio
Novelty: 0.00259764
Score: 0.83
Data Source: STRINGDB
GNAS
Tbio
Novelty: 0.00259764
Score: 0.83
Data Source: STRINGDB
GNAS
Tbio
Novelty: 0.00259764
Score: 0.83
Data Source: STRINGDB
PLD1
Tchem
Family: Enzyme
Novelty: 0.00756297
Score: 0.762
Data Source: STRINGDB
PLD2
Tchem
Family: Enzyme
Novelty: 0.00368183
Score: 0.756
Data Source: STRINGDB
PNPLA6
Tbio
Family: Enzyme
Novelty: 0.00194634
Score: 0.749
Data Source: STRINGDB
PLA2G7
Tchem
Family: Enzyme
Novelty: 0.00370934
Score: 0.707
Data Source: STRINGDB
Publication Statistics
PubMed Score  3.78

PubMed score by year
PubTator Score  2.99

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MESLSPGGPPGHPYQGEASTCWQLTVRVLEARNLRWADLLSEADPYVILQLSTAPGMKFKTKTLTDTSHP
1-70
VWNEAFRFLIQSQVKNVLELSIYDEDSVTEDDICFKVLYDISEVLPGKLLRKTFSQSPQGEEELDVEFLM
70-140
EETSDRPENLITNKVIVARELSCLDVHLDSTGSTAVVADQDKLELELVLKGSYEDTQTSFLGTASAFRFH
140-210
YMAALETELSGRLRSSRSNGWNGDNSAGYLTVPLRPLTIGKEVTMDVPAPNAPGVRLQLKAEGCPEELAV
210-280
HLGFNLCAEEQAFLSRRKQVVAKALKQALQLDRDLQEDEVPVVGIMATGGGARAMTSLYGHLLALQKLGL
280-350
LDCVTYFSGISGSTWTMAHLYGDPEWSQRDLEGPIRYAREHLAKSKLEVFSPERLASYRRELELRAEQGH
350-420
PTTFVDLWALVLESMLHGQVMDQKLSGQRAALERGQNPLPLYLSLNVKENNLETLDFKEWVEFSPYEVGF
420-490
LKYGAFVPPELFGSEFFMGRLMRRIPEPRICFLEAIWSNIFSLNLLDAWYDLTSSGESWKQHIKDKTRSL
490-560
EKEPLTTSGTSSRLEASWLQPGTALAQAFKGFLTGRPLHQRSPNFLQGLQLHQDYCSHKDFSTWADYQLD
560-630
SMPSQLTPKEPRLCLVDAAYFINTSSPSMFRPGRRLDLILSFDYSLSAPFEALQQTELYCRARGLPFPRV
630-700
EPSPQDQHQPRECHLFSDPACPEAPILLHFPLVNASFKDHSAPGVQRSPAELQGGQVDLTGATCPYTLSN
700-770
MTYKEEDFERLLRLSDYNVQTSQGAILQALRTALKHRTLEARPPRAQT
770-818
MESLSPGGPPGHPYQGEASTCWQLTVRVLEARNLRWADLLSEADPYVILQLSTAPGMKFKTKTLTDTSHPVWNEAFRFLIQSQVKNVLELSIYDEDSVTEDDICFKVLYDISEVLPGKLLRKTFSQSPQGEEELDVEFLMEETSDRPENLITNKVIVARELSCLDVHLDSTGSTAVVADQDKLELELVLKGSYEDTQTSFLGTASAFRFHYMAALETELSGRLRSSRSNGWNGDNSAGYLTVPLRPLTIGKEVTMDVPAPNAPGVRLQLKAEGCPEELAVHLGFNLCAEEQAFLSRRKQVVAKALKQALQLDRDLQEDEVPVVGIMATGGGARAMTSLYGHLLALQKLGLLDCVTYFSGISGSTWTMAHLYGDPEWSQRDLEGPIRYAREHLAKSKLEVFSPERLASYRRELELRAEQGHPTTFVDLWALVLESMLHGQVMDQKLSGQRAALERGQNPLPLYLSLNVKENNLETLDFKEWVEFSPYEVGFLKYGAFVPPELFGSEFFMGRLMRRIPEPRICFLEAIWSNIFSLNLLDAWYDLTSSGESWKQHIKDKTRSLEKEPLTTSGTSSRLEASWLQPGTALAQAFKGFLTGRPLHQRSPNFLQGLQLHQDYCSHKDFSTWADYQLDSMPSQLTPKEPRLCLVDAAYFINTSSPSMFRPGRRLDLILSFDYSLSAPFEALQQTELYCRARGLPFPRVEPSPQDQHQPRECHLFSDPACPEAPILLHFPLVNASFKDHSAPGVQRSPAELQGGQVDLTGATCPYTLSNMTYKEEDFERLLRLSDYNVQTSQGAILQALRTALKHRTLEARPPRAQT