You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
CIR1
Corepressor interacting with RBPJ 1

Protein Summary
Description
May modulate splice site selection during alternative splicing of pre-mRNAs (By similarity). Regulates transcription and acts as corepressor for RBPJ. Recruits RBPJ to the Sin3-histone deacetylase complex (HDAC). Required for RBPJ-mediated repression of transcription.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000342016
  • ENSP00000339723
  • ENSG00000138433

Symbol
  • CIR
  • CIR
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.85
kinase perturbation
0.71
tissue sample
0.63
small molecule perturbation
0.62
cellular component
0.55


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.08   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 124   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.08   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 124   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (47)
1 – 10 of 47
CCNYL1
Tdark
Novelty: 0.8
p_int: 0.998634212
p_ni: 0.001365433
p_wrong: 3.55e-7
Data Source: BioPlex
UBR3
Tbio
Family: Enzyme
Novelty: 0.11338583
p_int: 0.991181148
p_ni: 0.008818852
Data Source: BioPlex
GCA
Tbio
Novelty: 0.01013108
p_int: 0.9851867
p_ni: 0.014804243
p_wrong: 0.000009058
Score: 0.253
Data Source: BioPlex,STRINGDB
BTBD1
Tbio
Novelty: 0.32684825
p_int: 0.925493608
p_ni: 0.062364724
p_wrong: 0.012141669
Data Source: BioPlex
DCAF10
Tdark
Novelty: 10
p_int: 0.916234344
p_ni: 0.083765656
Score: 0.159
Data Source: BioPlex,STRINGDB
CDCA3
Tbio
Novelty: 0.07581263
p_int: 0.902113018
p_ni: 0.097670691
p_wrong: 0.000216291
Score: 0.189
Data Source: BioPlex,STRINGDB
RBM12
Tbio
Novelty: 0.10869565
p_int: 0.849772301
p_ni: 0.14265959
p_wrong: 0.007568108
Score: 0.169
Data Source: BioPlex,STRINGDB
CTNNA2
Tbio
Novelty: 0.00916859
p_int: 0.838129021
p_ni: 0.161870977
p_wrong: 2e-9
Score: 0.188
Data Source: BioPlex,STRINGDB
EPHA2
Tclin
Family: Kinase
Novelty: 0.00179986
p_int: 0.831155523
p_ni: 0.168843362
p_wrong: 0.000001114
Score: 0.173
Data Source: BioPlex,STRINGDB
RBPJ
Tbio
Family: TF
Novelty: 0.00198074
Score: 0.951
Data Source: STRINGDB
Publication Statistics
PubMed Score  2.08

PubMed score by year
PubTator Score  267.18

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGKSFANFMCKKDFHPASKSNIKKVWMAEQKISYDKKKQEELMQQYLKEQESYDNRLLMGDERVKNGLNF
1-70
MYEAPPGAKKENKEKEETEGETEYKFEWQKGAPREKYAKDDMNIRDQPFGIQVRNVRCIKCHKWGHVNTD
70-140
RECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSGFALKRNVLGRNLTANDPSQEYVASEGEEDPEV
140-210
EFLKSLTTKQKQKLLRKLDRLEKKKKKKDRKKKKFQKSRSKHKKHKSSSSSSSSSSSSSSTETSESSSES
210-280
ESNNKEKKIQRKKRKKNKCSGHNNSDSEEKDKSKKRKLHEELSSSHHNREKAKEKPRFLKHESSREDSKW
280-350
SHSDSDKKSRTHKHSPEKRGSERKEGSSRSHGREERSRRSRSRSPGSYKQRETRKRAQRNPGEEQSRRND
350-420
SRSHGTDLYRGEKMYREHPGGTHTKVTQRE
420-450
MGKSFANFMCKKDFHPASKSNIKKVWMAEQKISYDKKKQEELMQQYLKEQESYDNRLLMGDERVKNGLNFMYEAPPGAKKENKEKEETEGETEYKFEWQKGAPREKYAKDDMNIRDQPFGIQVRNVRCIKCHKWGHVNTDRECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSGFALKRNVLGRNLTANDPSQEYVASEGEEDPEVEFLKSLTTKQKQKLLRKLDRLEKKKKKKDRKKKKFQKSRSKHKKHKSSSSSSSSSSSSSSTETSESSSESESNNKEKKIQRKKRKKNKCSGHNNSDSEEKDKSKKRKLHEELSSSHHNREKAKEKPRFLKHESSREDSKWSHSDSDKKSRTHKHSPEKRGSERKEGSSRSHGREERSRRSRSRSPGSYKQRETRKRAQRNPGEEQSRRNDSRSHGTDLYRGEKMYREHPGGTHTKVTQRE