You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LSR
Lipolysis-stimulated lipoprotein receptor

Protein Summary
Description
Probable role in the clearance of triglyceride-rich lipoprotein from blood. Binds chylomicrons, LDL and VLDL in presence of free fatty acids and allows their subsequent uptake in the cells (By similarity).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000347609
  • ENSP00000262627
  • ENSG00000105699
  • ENST00000354900
  • ENSP00000346976
  • ENST00000360798
  • ENSP00000354034
  • ENST00000361790
  • ENSP00000354575
  • ENST00000427250
  • ENSP00000394479
  • ENST00000602122
  • ENSP00000472569
  • ENST00000621372
  • ENSP00000480821

Symbol
  • LISCH
  • ILDR3
  • LISCH7
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.75
transcription factor perturbation
0.74
transcription factor binding site profile
0.73
histone modification site profile
0.72
tissue
0.71


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 86.92   (req: < 5)
Gene RIFs: 9   (req: <= 3)
Antibodies: 159   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 86.92   (req: >= 5)
Gene RIFs: 9   (req: > 3)
Antibodies: 159   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (6)
LDL clearance (R-HSA-8964038)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
LDL clearance
Reactome
Plasma lipoprotein assembly, remodeling, and clearance
Reactome
Plasma lipoprotein clearance
Reactome
Transport of small molecules
Reactome
VLDL clearance
Name
Explore in Pharos
Explore in Source
LDL clearance
Plasma lipoprotein assembly, remodeling, and clearance
Plasma lipoprotein clearance
Transport of small molecules
VLDL clearance
Gene Ontology Terms (11)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
HGNC
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (109)
1 – 10 of 109
STON2
Tbio
Novelty: 0.03435283
p_int: 0.999990119
p_ni: 0.000009878
p_wrong: 3e-9
Score: 0.157
Data Source: BioPlex,STRINGDB
EPS15
Tbio
Novelty: 0.00518368
p_int: 0.999987547
p_ni: 0.000012453
Data Source: BioPlex
RALBP1
Tbio
Novelty: 0.0094994
p_int: 0.99991047
p_ni: 0.00008953
Data Source: BioPlex
EPS15L1
Tbio
Novelty: 0.08281964
p_int: 0.999754424
p_ni: 0.000245576
Data Source: BioPlex
SMAD5
Tbio
Family: TF
Novelty: 0.00607935
p_int: 0.999390886
p_ni: 0.00060373
p_wrong: 0.000005384
Score: 0.189
Data Source: BioPlex,STRINGDB
REPS1
Tbio
Novelty: 0.1445037
p_int: 0.998510466
p_ni: 0.001489531
p_wrong: 3e-9
Score: 0.529
Data Source: BioPlex,STRINGDB
LSMEM2
Tdark
p_int: 0.994275466
p_ni: 0.005724534
Data Source: BioPlex
ITSN1
Tbio
Novelty: 0.01483242
p_int: 0.992653153
p_ni: 0.007346847
Data Source: BioPlex
TGFA
Tbio
Novelty: 0.00259473
p_int: 0.989580621
p_ni: 0.010419379
Data Source: BioPlex
HFE
Tbio
Novelty: 0.00040976
p_int: 0.988640843
p_ni: 0.011359157
Data Source: BioPlex
Publication Statistics
PubMed Score  86.92

PubMed score by year
PubTator Score  26.57

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQQDGLGVGTRNGSGKGRSVHPSWPWCAPRPLRYFGRDARARRAQTAAMALLAGGLSRGLGSHPAAAGRD
1-70
AVVFVWLLLSTWCTAPARAIQVTVSNPYHVVILFQPVTLPCTYQMTSTPTQPIVIWKYKSFCRDRIADAF
70-140
SPASVDNQLNAQLAAGNPGYNPYVECQDSVRTVRVVATKQGNAVTLGDYYQGRRITITGNADLTFDQTAW
140-210
GDSGVYYCSVVSAQDLQGNNEAYAELIVLGRTSGVAELLPGFQAGPIEDWLFVVVVCLAAFLIFLLLGIC
210-280
WCQCCPHTCCCYVRCPCCPDKCCCPEALYAAGKAATSGVPSIYAPSTYAHLSPAKTPPPPAMIPMGPAYN
280-350
GYPGGYPGDVDRSSSAGGQGSYVPLLRDTDSSVASEVRSGYRIQASQQDDSMRVLYYMEKELANFDPSRP
350-420
GPPSGRVERAMSEVTSLHEDDWRSRPSRGPALTPIRDEEWGGHSPRSPRGWDQEPAREQAGGGWRARRPR
420-490
ARSVDALDDLTPPSTAESGSRSPTSNGGRSRAYMPPRSRSRDDLYDQDDSRDFPRSRDPHYDDFRSRERP
490-560
PADPRSHHHRTRDPRDNGSRSGDLPYDGRLLEEAVRKKGSEERRRPHKEEEEEAYYPPAPPPYSETDSQA
560-630
SRERRLKKNLALSRESLVV
630-649
MQQDGLGVGTRNGSGKGRSVHPSWPWCAPRPLRYFGRDARARRAQTAAMALLAGGLSRGLGSHPAAAGRDAVVFVWLLLSTWCTAPARAIQVTVSNPYHVVILFQPVTLPCTYQMTSTPTQPIVIWKYKSFCRDRIADAFSPASVDNQLNAQLAAGNPGYNPYVECQDSVRTVRVVATKQGNAVTLGDYYQGRRITITGNADLTFDQTAWGDSGVYYCSVVSAQDLQGNNEAYAELIVLGRTSGVAELLPGFQAGPIEDWLFVVVVCLAAFLIFLLLGICWCQCCPHTCCCYVRCPCCPDKCCCPEALYAAGKAATSGVPSIYAPSTYAHLSPAKTPPPPAMIPMGPAYNGYPGGYPGDVDRSSSAGGQGSYVPLLRDTDSSVASEVRSGYRIQASQQDDSMRVLYYMEKELANFDPSRPGPPSGRVERAMSEVTSLHEDDWRSRPSRGPALTPIRDEEWGGHSPRSPRGWDQEPAREQAGGGWRARRPRARSVDALDDLTPPSTAESGSRSPTSNGGRSRAYMPPRSRSRDDLYDQDDSRDFPRSRDPHYDDFRSRERPPADPRSHHHRTRDPRDNGSRSGDLPYDGRLLEEAVRKKGSEERRRPHKEEEEEAYYPPAPPPYSETDSQASRERRLKKNLALSRESLVV