You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LCA5
Lebercilin

Protein Summary
Description
Might be involved in minus end-directed microtubule transport. This gene encodes a protein that is thought to be involved in centrosomal or ciliary functions. Mutations in this gene cause Leber congenital amaurosis type V. Alternatively spliced transcript variants are described. [provided by RefSeq, Oct 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000369846
  • ENSP00000358861
  • ENSG00000135338
  • ENST00000392959
  • ENSP00000376686

Symbol
  • C6orf152
  • C6orf152
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.88
microRNA
0.69
cell line
0.57
gene perturbation
0.53
transcription factor binding site profile
0.53


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 19   (req: < 5)
Gene RIFs: 12   (req: <= 3)
Antibodies: 106   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 19   (req: >= 5)
Gene RIFs: 12   (req: > 3)
Antibodies: 106   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
Ciliary landscape
WikiPathways
Ciliary landscape
WikiPathways
Thermogenesis
WikiPathways
Ferroptosis
Name
Explore in Pharos
Explore in Source
Ciliary landscape
Ciliary landscape
Thermogenesis
Ferroptosis
Gene Ontology Terms (5)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Protein-Protein Interactions (76)
1 – 10 of 76
TSPYL1
Tbio
Novelty: 0.09347181
p_int: 0.999966198
p_ni: 1.32e-7
p_wrong: 0.00003367
Score: 0.188
Data Source: BioPlex,STRINGDB
SSNA1
Tbio
Novelty: 0.01587092
p_int: 0.865567395
p_ni: 0.000395819
p_wrong: 0.134036786
Score: 0.577
Data Source: BioPlex,STRINGDB
ARMC8
Tbio
Novelty: 0.08450354
p_int: 0.818370241
p_ni: 0.181629759
Data Source: BioPlex
FAM161A
Tbio
Novelty: 0.07384226
Score: 0.858
Data Source: STRINGDB
SPATA7
Tbio
Novelty: 0.0863768
Score: 0.832
Data Source: STRINGDB
AIPL1
Tbio
Novelty: 0.01698342
Score: 0.801
Data Source: STRINGDB
NINL
Tbio
Novelty: 0.01881383
Score: 0.8
Data Source: STRINGDB
CEP290
Tbio
Novelty: 0.0076763
Score: 0.799
Data Source: STRINGDB
RD3
Tbio
Novelty: 0.01019584
Score: 0.797
Data Source: STRINGDB
TULP1
Tbio
Family: TF
Novelty: 0.02175202
Score: 0.792
Data Source: STRINGDB
Publication Statistics
PubMed Score  19.00

PubMed score by year
PubTator Score  21.38

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGERAGSPGTDQERKAGKHHYSYLSDFETPQSSGRSSLVSSSPASVRRKNPKRQTSDGQVHHQAPRKPSP
1-70
KGLPNRKGVRVGFRSQSLNREPLRKDTDLVTKRILSARLLKINELQNEVSELQVKLAELLKENKSLKRLQ
70-140
YRQEKALNKFEDAENEISQLIFRHNNEITALKERLRKSQEKERATEKRVKDTESELFRTKFSLQKLKEIS
140-210
EARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELSTNSFQRQLLAERKRAYEAHDENKVLQKEVQR
210-280
LYHKLKEKERELDIKNIYSNRLPKSSPNKEKELALRKNAACQSDFADLCTKGVQTMEDFKPEEYPLTPET
280-350
IMCYENKWEEPGHLTLDLQSQKQDRHGEAGILNPIMEREEKFVTDEELHVVKQEVEKLEDEWEREELDKK
350-420
QKEKASLLEREEKPEWETGRYQLGMYPIQNMDKLQGEEEERLKREMLLAKLNEIDRELQDSRNLKYPVLP
420-490
LLPDFESKLHSPERSPKTYRFSESSERLFNGHHLQDISFSTPKGEGQNSGNVRSPASPNEFAFGSYVPSF
490-560
AKTSERSNPFSQKSSFLDFQRNSMEKLSKDGVDLITRKEKKANLMEQLFGASGSSTISSKSSDPNSVASS
560-630
KGDIDPLNFLPGNKGSRDQEHDEDEGFFLSEGRSFNPNRHRLKHADDKPAVKAADSVEDEIEEVALR
630-697
MGERAGSPGTDQERKAGKHHYSYLSDFETPQSSGRSSLVSSSPASVRRKNPKRQTSDGQVHHQAPRKPSPKGLPNRKGVRVGFRSQSLNREPLRKDTDLVTKRILSARLLKINELQNEVSELQVKLAELLKENKSLKRLQYRQEKALNKFEDAENEISQLIFRHNNEITALKERLRKSQEKERATEKRVKDTESELFRTKFSLQKLKEISEARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELSTNSFQRQLLAERKRAYEAHDENKVLQKEVQRLYHKLKEKERELDIKNIYSNRLPKSSPNKEKELALRKNAACQSDFADLCTKGVQTMEDFKPEEYPLTPETIMCYENKWEEPGHLTLDLQSQKQDRHGEAGILNPIMEREEKFVTDEELHVVKQEVEKLEDEWEREELDKKQKEKASLLEREEKPEWETGRYQLGMYPIQNMDKLQGEEEERLKREMLLAKLNEIDRELQDSRNLKYPVLPLLPDFESKLHSPERSPKTYRFSESSERLFNGHHLQDISFSTPKGEGQNSGNVRSPASPNEFAFGSYVPSFAKTSERSNPFSQKSSFLDFQRNSMEKLSKDGVDLITRKEKKANLMEQLFGASGSSTISSKSSDPNSVASSKGDIDPLNFLPGNKGSRDQEHDEDEGFFLSEGRSFNPNRHRLKHADDKPAVKAADSVEDEIEEVALR