You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
VPS36
Vacuolar protein-sorting-associated protein 36

Protein Summary
Description
Component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. Its ability to bind ubiquitin probably plays a role in endosomal sorting of ubiquitinated cargo proteins by ESCRT complexes. The ESCRT-II complex may also play a role in transcription regulation, possibly via its interaction with ELL. Binds phosphoinosides such as PtdIns(3,4,5)P3. This gene encodes a protein that is a subunit of the endosomal sorting complex required for transport II (ESCRT-II). This protein complex functions in sorting of ubiquitinated membrane proteins during endocytosis. A similar protein complex in rat is associated with RNA polymerase elongation factor II. [provided by RefSeq, A ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000378060
  • ENSP00000367299
  • ENSG00000136100
  • ENST00000611132
  • ENSP00000484968

Symbol
  • C13orf9
  • EAP45
  • EAP45
  • C13orf9
  • CGI-145
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
0.98
kinase perturbation
0.88
transcription factor binding site profile
0.82
cellular component
0.71
tissue sample
0.69


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 21.92   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 51   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 21.92   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 51   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (4)
Endosomal Sorting Complex Required For Transport (ESCRT) (R-HSA-917729)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Endosomal Sorting Complex Required For Transport (ESCRT)
Reactome
Membrane Trafficking
Reactome
Vesicle-mediated transport
Name
Explore in Pharos
Explore in Source
Endosomal Sorting Complex Required For Transport (ESCRT)
Membrane Trafficking
Vesicle-mediated transport
Protein-Protein Interactions (98)
1 – 10 of 98
VPS25
Tbio
Novelty: 0.05198234
p_int: 1
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
SNF8
Tbio
Novelty: 0.0473195
p_int: 1
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
UBB
Tbio
Novelty: 0.00895161
p_int: 0.999007885
p_ni: 0.000992115
Score: 0.991
Data Source: BioPlex,STRINGDB
SLC25A41
Tdark
Family: Transporter
Novelty: 2.02597403
p_int: 0.9953707
p_ni: 0.001276252
p_wrong: 0.003353048
Data Source: BioPlex
CTLA4
Tclin
Novelty: 0.00017405
p_int: 0.994907883
p_ni: 0.005065165
p_wrong: 0.000026952
Data Source: BioPlex
KDELR1
Tbio
Novelty: 0.00508166
p_int: 0.993252316
p_ni: 0.002436212
p_wrong: 0.004311471
Score: 0.208
Data Source: BioPlex,STRINGDB
HERC1
Tbio
Family: Enzyme
Novelty: 0.08775031
p_int: 0.827351989
p_ni: 0.172647877
p_wrong: 1.34e-7
Score: 0.228
Data Source: BioPlex,STRINGDB
CHMP6
Tbio
Novelty: 0.0478065
Score: 0.998
Data Source: STRINGDB
VPS28
Tbio
Novelty: 0.04542177
Score: 0.998
Data Source: Reactome,STRINGDB
TSG101
Tbio
Novelty: 0.00310287
Score: 0.995
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  21.92

PubMed score by year
PubTator Score  6.4

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDRFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMAILLSQIVFIE
1-70
EQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSL
70-140
QTNRGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFEDLSKLMIKAKEMVELSKSIANKIKDKQGDIT
140-210
EDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGME
210-280
LLSPEDLVNACKMLEALKLPLRLRVFDSGVMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSV
280-350
LLAKERLLLAEKMGHLCRDDSVEGLRFYPNLFMTQS
350-386
MDRFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMAILLSQIVFIEEQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSLQTNRGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFEDLSKLMIKAKEMVELSKSIANKIKDKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACKMLEALKLPLRLRVFDSGVMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSVLLAKERLLLAEKMGHLCRDDSVEGLRFYPNLFMTQS