You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LRRTM3
Leucine-rich repeat transmembrane neuronal protein 3

Protein Classes
Protein Summary
Description
Exhibits a limited synaptogenic activity in vitro, restricted to excitatory presynaptic differentiation (By similarity). May play a role in the development and maintenance of the vertebrate nervous system.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000361320
  • ENSP00000355187
  • ENSG00000198739
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
microRNA
0.77
cell type or tissue
0.7
transcription factor binding site profile
0.65
PubMedID
0.55
cell line
0.5


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.87   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 71   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.87   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 71   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
Neurexins and neuroligins (R-HSA-6794361)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Neurexins and neuroligins
Reactome
Neuronal System
Reactome
Protein-protein interactions at synapses
Name
Explore in Pharos
Explore in Source
Neurexins and neuroligins
Neuronal System
Protein-protein interactions at synapses
Protein-Protein Interactions (45)
1 – 10 of 45
LRRTM4
Tbio
Novelty: 0.17645205
p_int: 0.999990346
p_ni: 5e-9
p_wrong: 0.000009649
Data Source: BioPlex
NRXN1
Tbio
Novelty: 0.00863427
Score: 0.975
Data Source: STRINGDB
NRXN1
Tbio
Novelty: 0.00863427
Score: 0.975
Data Source: STRINGDB
NRXN2
Tbio
Novelty: 0.02248397
Score: 0.972
Data Source: STRINGDB
NRXN2
Tbio
Novelty: 0.02248397
Score: 0.972
Data Source: STRINGDB
NRXN3
Tbio
Novelty: 0.01732789
Score: 0.971
Data Source: STRINGDB
NRXN3
Tbio
Novelty: 0.01732789
Score: 0.971
Data Source: STRINGDB
B3GNT3
Tbio
Family: Enzyme
Novelty: 0.05453491
Score: 0.807
Data Source: STRINGDB
CTNNA3
Tbio
Novelty: 0.02196369
Score: 0.803
Data Source: STRINGDB
TBC1D12
Tdark
Novelty: 0.59607843
Score: 0.764
Data Source: STRINGDB
Publication Statistics
PubMed Score  5.87

PubMed score by year
PubTator Score  4.16

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGFNVIRLLSGSAVALVIAPTVLLTMLSSAERGCPKGCRCEGKMVYCESQKLQEIPSSISAGCLGLSLRY
1-70
NSLQKLKYNQFKGLNQLTWLYLDHNHISNIDENAFNGIRRLKELILSSNRISYFLNNTFRPVTNLRNLDL
70-140
SYNQLHSLGSEQFRGLRKLLSLHLRSNSLRTIPVRIFQDCRNLELLDLGYNRIRSLARNVFAGMIRLKEL
140-210
HLEHNQFSKLNLALFPRLVSLQNLYLQWNKISVIGQTMSWTWSSLQRLDLSGNEIEAFSGPSVFQCVPNL
210-280
QRLNLDSNKLTFIGQEILDSWISLNDISLAGNIWECSRNICSLVNWLKSFKGLRENTIICASPKELQGVN
280-350
VIDAVKNYSICGKSTTERFDLARALPKPTFKPKLPRPKHESKPPLPPTVGATEPGPETDADAEHISFHKI
350-420
IAGSVALFLSVLVILLVIYVSWKRYPASMKQLQQRSLMRRHRKKKRQSLKQMTPSTQEFYVDYKPTNTET
420-490
SEMLLNGTGPCTYNKSGSRECEIPLSMNVSTFLAYDQPTISYCGVHHELLSHKSFETNAQEDTMETHLET
490-560
ELDLSTITTAGRISDHKQQLA
560-581
MGFNVIRLLSGSAVALVIAPTVLLTMLSSAERGCPKGCRCEGKMVYCESQKLQEIPSSISAGCLGLSLRYNSLQKLKYNQFKGLNQLTWLYLDHNHISNIDENAFNGIRRLKELILSSNRISYFLNNTFRPVTNLRNLDLSYNQLHSLGSEQFRGLRKLLSLHLRSNSLRTIPVRIFQDCRNLELLDLGYNRIRSLARNVFAGMIRLKELHLEHNQFSKLNLALFPRLVSLQNLYLQWNKISVIGQTMSWTWSSLQRLDLSGNEIEAFSGPSVFQCVPNLQRLNLDSNKLTFIGQEILDSWISLNDISLAGNIWECSRNICSLVNWLKSFKGLRENTIICASPKELQGVNVIDAVKNYSICGKSTTERFDLARALPKPTFKPKLPRPKHESKPPLPPTVGATEPGPETDADAEHISFHKIIAGSVALFLSVLVILLVIYVSWKRYPASMKQLQQRSLMRRHRKKKRQSLKQMTPSTQEFYVDYKPTNTETSEMLLNGTGPCTYNKSGSRECEIPLSMNVSTFLAYDQPTISYCGVHHELLSHKSFETNAQEDTMETHLETELDLSTITTAGRISDHKQQLA