You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ADIPOR2
Adiponectin receptor protein 2

Protein Classes
Protein Summary
Description
Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism (PubMed:12802337, PubMed:25855295). Required for normal body fat and glucose homeostasis. ADIPOQ-binding activates a signaling cascade that leads to increased PPARA activity, and ultimately to increased fatty acid oxidation and glucose uptake. Has intermediate affinity for globular and full-length adiponectin. Required for normal revascularization after chronic ischemia caused by severing of blood vessels (By similarity). The adiponectin receptors, ADIPOR1 (MIM 607945) and ADIPOR2, serve as receptors for globular and full-length adiponectin (MIM 605441) and mediate increased AMPK (see MIM 602739) and PPAR-alpha (PPARA; MIM 170998) ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin (Yamauchi et al., 2003 [PubMed 12802337]).[supplied by OMIM, Mar 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000357103
  • ENSP00000349616
  • ENSG00000006831
  • ENST00000645126
  • ENSP00000495699
  • ENSG00000285070

Symbol
  • PAQR2
  • PAQR2
  • ACDCR2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
kinase perturbation
0.88
transcription factor binding site profile
0.84
virus perturbation
0.83
biological term
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 187.83   (req: < 5)
Gene RIFs: 119   (req: <= 3)
Antibodies: 238   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 187.83   (req: >= 5)
Gene RIFs: 119   (req: > 3)
Antibodies: 238   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 18
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (34)
AMPK inhibits chREBP transcriptional activation activity (R-HSA-163680)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
AMPK inhibits chREBP transcriptional activation activity
Reactome
Integration of energy metabolism
Reactome
Metabolism
Name
Explore in Pharos
Explore in Source
AMPK inhibits chREBP transcriptional activation activity
Integration of energy metabolism
Metabolism
Gene Ontology Terms (21)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (54)
1 – 10 of 54
RNF181
Tbio
Family: Enzyme
Novelty: 0.33426184
p_int: 0.996441225
p_ni: 0.002762872
p_wrong: 0.000795903
Score: 0.323
Data Source: BioPlex,STRINGDB
NCK1
Tbio
Novelty: 0.00554007
p_int: 0.993398159
p_ni: 0.002724237
p_wrong: 0.003877604
Score: 0.455
Data Source: BioPlex,STRINGDB
ADIPOQ
Tbio
Novelty: 0.00013138
Score: 0.994
Data Source: Reactome,STRINGDB
APPL1
Tbio
Novelty: 0.00169114
Score: 0.978
Data Source: STRINGDB
PRKAA2
Tchem
Family: Kinase
Novelty: 0.03339241
Score: 0.922
Data Source: STRINGDB
MLXIPL
Tbio
Family: TF
Novelty: 0.00433933
Score: 0.921
Data Source: STRINGDB
PRKAB2
Tchem
Family: Enzyme
Novelty: 0.05936112
Score: 0.915
Data Source: STRINGDB
PRKAG2
Tbio
Family: Enzyme
Novelty: 0.00943315
Score: 0.907
Data Source: STRINGDB
ADIPOR1
Tbio
Novelty: 0.00339654
Score: 0.902
Data Source: Reactome,STRINGDB
INS
Tbio
Novelty: 0.00000614
Score: 0.832
Data Source: STRINGDB
Publication Statistics
PubMed Score  187.83

PubMed score by year
PubTator Score  178.02

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQ
1-70
EDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIF
70-140
RIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEG
140-210
VSRLFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAG
210-280
VFLGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQL
280-350
FHIFVVAGAFVHFHGVSNLQEFRFMIGGGCSEEDAL
350-386
MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFMIGGGCSEEDAL