You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
CCDC84
Coiled-coil domain-containing protein 84

Protein Summary
Description
This gene encodes a protein thought to contain a coiled coil motif. No function has been determined for the encoded protein. A pseudogene of this gene is located on chromosome 20. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000334418
  • ENSP00000334767
  • ENSG00000186166
  • ENST00000625528
  • ENSP00000487197
  • ENSG00000280975

Symbol
  • DLNB14
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.93
cell type or tissue
0.81
transcription factor binding site profile
0.69
tissue sample
0.6
tissue
0.59


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.02   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 80   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.02   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 80   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (29)
1 – 10 of 29
TXNL4B
Tbio
Novelty: 0.00158517
p_int: 0.999998492
p_ni: 1.6e-8
p_wrong: 0.000001493
Score: 0.54
Data Source: BioPlex,STRINGDB
PRPF3
Tbio
Novelty: 0.01841457
p_int: 0.999991025
p_ni: 0.000008975
Score: 0.692
Data Source: BioPlex,STRINGDB
SNRPGP15
Tdark
p_int: 0.999959377
p_ni: 0.000001462
p_wrong: 0.000039161
Data Source: BioPlex
TUT1
Tbio
Family: Enzyme
Novelty: 0.0189148
p_int: 0.999007089
p_ni: 0.000992905
p_wrong: 6e-9
Score: 0.874
Data Source: BioPlex,STRINGDB
SNRPE
Tbio
Novelty: 0.00150118
p_int: 0.99750524
p_ni: 0.000014511
p_wrong: 0.002480249
Score: 0.534
Data Source: BioPlex,STRINGDB
WDR83
Tbio
Novelty: 0.06422509
p_int: 0.987147941
p_ni: 0.012852059
Score: 0.198
Data Source: BioPlex,STRINGDB
GINS1
Tbio
Novelty: 0.21919143
p_int: 0.848772677
p_ni: 0.151205342
p_wrong: 0.000021981
Score: 0.228
Data Source: BioPlex,STRINGDB
SART3
Tbio
Novelty: 0.02812047
p_int: 0.83619957
p_ni: 0.16380043
Score: 0.534
Data Source: BioPlex,STRINGDB
TOR1AIP2
Tbio
Novelty: 0.17774016
Score: 0.732
Data Source: STRINGDB
TOR1AIP2
Tbio
Novelty: 0.17774016
Score: 0.732
Data Source: STRINGDB
Publication Statistics
PubMed Score  0.02

PubMed score by year
PubTator Score  0.03

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAPAQRCPLCRQTFFCGRGHVYSRKHQRQLKEALERLLPQVEAARKAIRAAQVERYVPEHERCCWCLCCG
1-70
CEVREHLSHGNLTVLYGGLLEHLASPEHKKATNKFWWENKAEVQMKEKFLVTPQDYARFKKSMVKGLDSY
70-140
EEKEDKVIKEMAAQIREVEQSRQEVVRSVLEPQAVPDPEEGSSAPRSWKGMNSQVASSLQQPSNLDLPPA
140-210
PELDWMETGPSLTFIGHQDIPGVGNIHSGATPPWMIQDEEYIAGNQEIGPSYEEFLKEKEKQKLKKLPPD
210-280
RVGANFDHSSRTSAGWLPSFGRVWNNGRRWQSRHQFKTEAAAMKKQSHTEKS
280-332
MAPAQRCPLCRQTFFCGRGHVYSRKHQRQLKEALERLLPQVEAARKAIRAAQVERYVPEHERCCWCLCCGCEVREHLSHGNLTVLYGGLLEHLASPEHKKATNKFWWENKAEVQMKEKFLVTPQDYARFKKSMVKGLDSYEEKEDKVIKEMAAQIREVEQSRQEVVRSVLEPQAVPDPEEGSSAPRSWKGMNSQVASSLQQPSNLDLPPAPELDWMETGPSLTFIGHQDIPGVGNIHSGATPPWMIQDEEYIAGNQEIGPSYEEFLKEKEKQKLKKLPPDRVGANFDHSSRTSAGWLPSFGRVWNNGRRWQSRHQFKTEAAAMKKQSHTEKS