You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RPAIN
RPA-interacting protein

Protein Summary
Description
Mediates the import of RPA complex into the nucleus, possibly via some interaction with importin beta. Isoform 2 is sumoylated and mediates the localization of RPA complex into the PML body of the nucleus, thereby participating in RPA function in DNA metabolism.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000327154
  • ENSP00000315069
  • ENSG00000129197
  • ENST00000381208
  • ENSP00000370605
  • ENST00000381209
  • ENSP00000370606
  • ENST00000405578
  • ENSP00000385814
  • ENST00000536255
  • ENSP00000439939
  • ENST00000539417
  • ENSP00000446453
  • ENST00000571558
  • ENSP00000458699
  • ENST00000573577
  • ENSP00000460162
  • ENST00000574003
  • ENSP00000467178
  • ENST00000575112
  • ENSP00000460354
  • ENST00000575599
  • ENSP00000458218

Symbol
  • RIP
  • RIP
  • HRIP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.87
transcription factor perturbation
0.74
transcription factor binding site profile
0.72
cellular component
0.67
kinase perturbation
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 23.97   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 169   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 23.97   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 169   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (11)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
MGI
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (27)
1 – 10 of 27
RPA1
Tchem
Novelty: 0.00309278
p_int: 0.990373827
p_ni: 0.009626173
Score: 0.88
Data Source: BioPlex,STRINGDB
UBR7
Tdark
Family: Epigenetic
Novelty: 0.29723673
p_int: 0.95989729
p_ni: 0.04010271
Score: 0.534
Data Source: BioPlex,STRINGDB
RPA2
Tbio
Novelty: 0.01534532
Score: 0.759
Data Source: STRINGDB
TIPRL
Tbio
Novelty: 0.02626584
Score: 0.65
Data Source: STRINGDB
CTNNA1
Tbio
Novelty: 0.0104485
Score: 0.58
Data Source: STRINGDB
DDX1
Tbio
Family: Enzyme
Novelty: 0.02059942
Score: 0.576
Data Source: STRINGDB
C1QBP
Tbio
Novelty: 0.00278686
Score: 0.568
Data Source: STRINGDB
RAD51B
Tbio
Novelty: 0.00989414
Score: 0.531
Data Source: STRINGDB
SNRNP27
Tbio
Novelty: 0.00944493
Score: 0.53
Data Source: STRINGDB
NUPL2
Tbio
Novelty: 0.08479709
Score: 0.525
Data Source: STRINGDB
Publication Statistics
PubMed Score  23.97

PubMed score by year
PubTator Score  17.2

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAESLRSPRRSLYKLVGSPPWKEAFRQRCLERMRNSRDRLLNRYRQAGSSGPGNSQNSFLVQEVMEEEWN
1-70
ALQSVENCPEDLAQLEELIDMAVLEEIQQELINQEQSIISEYEKSLQFDEKCLSIMLAEWEANPLICPVC
70-140
TKYNLRITSGVVVCQCGLSIPSHSSELTEQKLRACLEGSINEHSAHCPHTPEFSVTGGTEEKSSLLMSCL
140-210
ACDTWAVIL
210-219
MAESLRSPRRSLYKLVGSPPWKEAFRQRCLERMRNSRDRLLNRYRQAGSSGPGNSQNSFLVQEVMEEEWNALQSVENCPEDLAQLEELIDMAVLEEIQQELINQEQSIISEYEKSLQFDEKCLSIMLAEWEANPLICPVCTKYNLRITSGVVVCQCGLSIPSHSSELTEQKLRACLEGSINEHSAHCPHTPEFSVTGGTEEKSSLLMSCLACDTWAVIL