You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PATL1
Protein PAT1 homolog 1

Protein Summary
Description
RNA-binding protein involved in deadenylation-dependent decapping of mRNAs, leading to the degradation of mRNAs. Acts as a scaffold protein that connects deadenylation and decapping machinery. Required for cytoplasmic mRNA processing body (P-body) assembly. In case of infection, required for translation and replication of hepatitis C virus (HCV).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000300146
  • ENSP00000300146
  • ENSG00000166889

Symbol
  • Pat1b
  • hPat1b
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein complex
0.96
virus perturbation
0.92
histone modification site profile
0.89
transcription factor binding site profile
0.78
transcription factor
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7.15   (req: < 5)
Gene RIFs: 9   (req: <= 3)
Antibodies: 82   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7.15   (req: >= 5)
Gene RIFs: 9   (req: > 3)
Antibodies: 82   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (4)
Deadenylation-dependent mRNA decay (R-HSA-429914)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Deadenylation-dependent mRNA decay
Reactome
Metabolism of RNA
Reactome
mRNA decay by 5' to 3' exoribonuclease
Name
Explore in Pharos
Explore in Source
Deadenylation-dependent mRNA decay
Metabolism of RNA
mRNA decay by 5' to 3' exoribonuclease
Gene Ontology Terms (11)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (96)
1 – 10 of 96
LSM6
Tdark
Novelty: 0.24061873
p_int: 0.999999998
p_ni: 2e-9
Score: 0.99
Data Source: BioPlex,STRINGDB
LSM5
Tbio
Novelty: 0.09756098
p_int: 0.99999999
p_ni: 1e-8
Score: 0.99
Data Source: BioPlex,STRINGDB
LSM3
Tbio
Novelty: 0.10679982
p_int: 0.999999957
p_ni: 4.3e-8
Score: 0.993
Data Source: BioPlex,STRINGDB
IGHM
Tbio
p_int: 0.999999898
p_ni: 1.02e-7
Data Source: BioPlex
LSM7
Tbio
Novelty: 0.0977271
p_int: 0.999999756
p_ni: 2.44e-7
Score: 0.983
Data Source: BioPlex,STRINGDB
LRFN4
Tbio
Novelty: 0.15441176
p_int: 0.999992474
p_ni: 0.000007525
Score: 0.158
Data Source: BioPlex,STRINGDB
QPRT
Tbio
Family: Enzyme
Novelty: 0.00969466
p_int: 0.999807741
p_ni: 0.000192259
Score: 0.212
Data Source: BioPlex,STRINGDB
NAGK
Tbio
Family: Kinase
Novelty: 0.02300466
p_int: 0.994686812
p_ni: 0.005313186
p_wrong: 2e-9
Score: 0.174
Data Source: BioPlex,STRINGDB
MYO18A
Tbio
Novelty: 0.06114368
p_int: 0.916307527
p_ni: 0.083692473
Score: 0.165
Data Source: BioPlex,STRINGDB
LSM1
Tbio
Novelty: 0.00857865
Score: 0.999
Data Source: STRINGDB
Publication Statistics
PubMed Score  7.15

PubMed score by year
PubTator Score  6.08

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MFRYESLEDCPLDEDEDAFQGLGEEDEEIDQFNDDTFGSGAVDDDWQEAHERLAELEEKLPVAVNEQTGN
1-70
GERDEMDLLGDHEENLAERLSKMVIENELEDPAIMRAVQTRPVLQPQPGSLNSSIWDGSEVLRRIRGPLL
70-140
AQEMPTVSVLEYALPQRPPQGPEDDRDLSERALPRRSTSPIIGSPPVRAVPIGTPPKQMAVPSFTQQILC
140-210
PKPVHVRPPMPPRYPAPYGERMSPNQLCSVPNSSLLGHPFPPSVPPVLSPLQRAQLLGGAQLQPGRMSPS
210-280
QFARVPGFVGSPLAAMNPKLLQGRVGQMLPPAPGFRAFFSAPPSATPPPQQHPPGPGPHLQNLRSQAPMF
280-350
RPDTTHLHPQHRRLLHQRQQQNRSQHRNLNGAGDRGSHRSSHQDHLRKDPYANLMLQREKDWVSKIQMMQ
350-420
LQSTDPYLDDFYYQNYFEKLEKLSAAEEIQGDGPKKERTKLITPQVAKLEHAYKPVQFEGSLGKLTVSSV
420-490
NNPRKMIDAVVTSRSEDDETKEKQVRDKRRKTLVIIEKTYSLLLDVEDYERRYLLSLEEERPALMDDRKH
490-560
KICSMYDNLRGKLPGQERPSDDHFVQIMCIRKGKRMVARILPFLSTEQAADILMTTARNLPFLIKKDAQD
560-630
EVLPCLLSPFSLLLYHLPSVSITSLLRQLMNLPQSAATPALSNPHLTAVLQNKFGLSLLLILLSRGEDLQ
630-700
SSDPATESTQNNQWTEVMFMATRELLRIPQAALAKPISIPTNLVSLFSRYVDRQKLNLLETKLQLVQGIR
700-770
MFRYESLEDCPLDEDEDAFQGLGEEDEEIDQFNDDTFGSGAVDDDWQEAHERLAELEEKLPVAVNEQTGNGERDEMDLLGDHEENLAERLSKMVIENELEDPAIMRAVQTRPVLQPQPGSLNSSIWDGSEVLRRIRGPLLAQEMPTVSVLEYALPQRPPQGPEDDRDLSERALPRRSTSPIIGSPPVRAVPIGTPPKQMAVPSFTQQILCPKPVHVRPPMPPRYPAPYGERMSPNQLCSVPNSSLLGHPFPPSVPPVLSPLQRAQLLGGAQLQPGRMSPSQFARVPGFVGSPLAAMNPKLLQGRVGQMLPPAPGFRAFFSAPPSATPPPQQHPPGPGPHLQNLRSQAPMFRPDTTHLHPQHRRLLHQRQQQNRSQHRNLNGAGDRGSHRSSHQDHLRKDPYANLMLQREKDWVSKIQMMQLQSTDPYLDDFYYQNYFEKLEKLSAAEEIQGDGPKKERTKLITPQVAKLEHAYKPVQFEGSLGKLTVSSVNNPRKMIDAVVTSRSEDDETKEKQVRDKRRKTLVIIEKTYSLLLDVEDYERRYLLSLEEERPALMDDRKHKICSMYDNLRGKLPGQERPSDDHFVQIMCIRKGKRMVARILPFLSTEQAADILMTTARNLPFLIKKDAQDEVLPCLLSPFSLLLYHLPSVSITSLLRQLMNLPQSAATPALSNPHLTAVLQNKFGLSLLLILLSRGEDLQSSDPATESTQNNQWTEVMFMATRELLRIPQAALAKPISIPTNLVSLFSRYVDRQKLNLLETKLQLVQGIR