You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GPR149
Probable G-protein coupled receptor 149

Protein Summary
Description
Orphan receptor. This gene encodes a seven-transmembrane G protein coupled receptor (GPCR) class A family member. Although categorized as a class A GPCR, the encoded protein lacks the first two charged amino acids of the highly conserved Asp-Arg-Tyr (DRY) motif found in the third transmembrane helix of class A receptors which is important for efficient G protein-coupled signal transduction. Mice with a knockout of the orthologous gene are viable and have normal maturation of the ovarian follicle, but show enhanced fertility and ovulation. All GPCRs have a common structural architecture consisting of seven transmembrane alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptor, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind t ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000389740
  • ENSP00000374390
  • ENSG00000174948

Symbol
  • PGR10
  • R35
  • IEDA
  • PGR10
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell line
0.67
gene perturbation
0.53
phenotype
0.42
tissue
0.42
virus perturbation
0.41


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 30.06   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 200   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 30.06   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 200   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (134)
1 – 10 of 134
DDX49
Tbio
Family: Enzyme
Novelty: 0.15014437
Score: 0.667
Data Source: STRINGDB
NOP56
Tbio
Novelty: 0.02124982
Score: 0.635
Data Source: STRINGDB
DDX31
Tbio
Family: Enzyme
Novelty: 4
Score: 0.633
Data Source: STRINGDB
DDX10
Tbio
Family: Enzyme
Novelty: 0.03194237
Score: 0.629
Data Source: STRINGDB
DDX52
Tbio
Family: Enzyme
Novelty: 0.06516833
Score: 0.624
Data Source: STRINGDB
BMS1
Tbio
Novelty: 0.03384117
Score: 0.622
Data Source: STRINGDB
RBM28
Tbio
Novelty: 0.01991731
Score: 0.622
Data Source: STRINGDB
NHP2
Tbio
Novelty: 0.02966451
Score: 0.621
Data Source: STRINGDB
KRI1
Tbio
Novelty: 0.10273973
Score: 0.61
Data Source: STRINGDB
JMJD1C
Tbio
Family: Epigenetic
Novelty: 0.04704005
Score: 0.607
Data Source: STRINGDB
Publication Statistics
PubMed Score  30.06

PubMed score by year
PubTator Score  3.04

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MSLFLSNLSTNDSSLWKENHNSTDLLNPPGTLNIYLFCLTCLMTFAALVGSIYSLISLLKMQNRTVVSML
1-70
VASWSVDDLMSVLSVTIFMFLQWPNEVPGYFQFLCTTSALMYLCQGLSSNLKATLLVSYNFYTMHRGVGS
70-140
QTASRRSGQVLGVVLTVWAASLLLSALPLCGWGAFVRTPWGCLVDCSSSYVLFLSIVYALAFGLLVGLSV
140-210
PLTHRLLCSEEPPRLHSNYQEISRGASIPGTPPTAGRVVSLSPEDAPGPSLRRSGGCSPSSDTVFGPGAP
210-280
AAAGAEACRRENRGTLYGTRSFTVSVAQKRFALILALTKVVLWLPMMMHMVVQNVVGFQSLPLETFSFLL
280-350
TLLATTVTPVFVLSKRWTHLPCGCIINCRQNAYAVASDGKKIKRKGFEFNLSFQKSYGIYKIAHEDYYDD
350-420
DENSIFYHNLMNSECETTKDPQRDNRNIFNAIKVEISTTPSLDSSTQRGINKCTNTDITEAKQDSNNKKD
420-490
AFSDKTGGDINYEETTFSEGPERRLSHEESQKPDLSDWEWCRSKSERTPRQRSGYALAIPLCAFQGTVSL
490-560
HAPTGKTLSLSTYEVSAEGQKITPASKKIEVYRSKSVGHEPNSEDSSSTFVDTSVKIHLEVLEICDNEEA
560-630
LDTVSIISNISQSSTQVRSPSLRYSRKENRFVSCDLGETASYSLFLPTSNPDGDINISIPDTVEAHRQNS
630-700
KRQHQERDGYQEEIQLLNKAYRKREEESKGS
700-731
MSLFLSNLSTNDSSLWKENHNSTDLLNPPGTLNIYLFCLTCLMTFAALVGSIYSLISLLKMQNRTVVSMLVASWSVDDLMSVLSVTIFMFLQWPNEVPGYFQFLCTTSALMYLCQGLSSNLKATLLVSYNFYTMHRGVGSQTASRRSGQVLGVVLTVWAASLLLSALPLCGWGAFVRTPWGCLVDCSSSYVLFLSIVYALAFGLLVGLSVPLTHRLLCSEEPPRLHSNYQEISRGASIPGTPPTAGRVVSLSPEDAPGPSLRRSGGCSPSSDTVFGPGAPAAAGAEACRRENRGTLYGTRSFTVSVAQKRFALILALTKVVLWLPMMMHMVVQNVVGFQSLPLETFSFLLTLLATTVTPVFVLSKRWTHLPCGCIINCRQNAYAVASDGKKIKRKGFEFNLSFQKSYGIYKIAHEDYYDDDENSIFYHNLMNSECETTKDPQRDNRNIFNAIKVEISTTPSLDSSTQRGINKCTNTDITEAKQDSNNKKDAFSDKTGGDINYEETTFSEGPERRLSHEESQKPDLSDWEWCRSKSERTPRQRSGYALAIPLCAFQGTVSLHAPTGKTLSLSTYEVSAEGQKITPASKKIEVYRSKSVGHEPNSEDSSSTFVDTSVKIHLEVLEICDNEEALDTVSIISNISQSSTQVRSPSLRYSRKENRFVSCDLGETASYSLFLPTSNPDGDINISIPDTVEAHRQNSKRQHQERDGYQEEIQLLNKAYRKREEESKGS