You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ZER1
Protein zer-1 homolog

Protein Summary
Description
Probably acts as target recruitment subunit in the E3 ubiquitin ligase complex ZER1-CUL2-Elongin BC. This gene encodes a subunit of an E3 ubiquitin ligase complex that may be involved in meiosis. The encoded protein contains three leucine-rich repeat motifs. [provided by RefSeq, Nov 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000291900
  • ENSP00000291900
  • ENSG00000160445

Symbol
  • C9orf60
  • ZYG
  • ZYG11BL
  • ZYG
  • C9orf60
  • ZYG11BL
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.79
cell line
0.7
transcription factor binding site profile
0.7
microRNA
0.68
small molecule perturbation
0.67


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 16.79   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 69   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 16.79   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 69   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (3)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (60)
1 – 10 of 60
RTBDN
Tdark
Novelty: 0.23076923
p_int: 0.993503721
p_ni: 0.006496278
Score: 0.189
Data Source: BioPlex,STRINGDB
LYG2
Tbio
Family: Enzyme
Novelty: 0.15083867
p_int: 0.98265261
p_ni: 0.017346779
p_wrong: 6.11e-7
Data Source: BioPlex
MRM1
Tbio
Family: Enzyme
Novelty: 0.27243243
p_int: 0.979079697
p_ni: 0.020920303
Data Source: BioPlex
SPINK7
Tbio
Family: Enzyme
Novelty: 0.02271437
p_int: 0.979022995
p_ni: 0.020977005
Data Source: BioPlex
CUTA
Tbio
Novelty: 0.02217139
p_int: 0.976720146
p_ni: 0.023279854
Score: 0.173
Data Source: BioPlex,STRINGDB
STMN2
Tbio
Novelty: 0.01092062
p_int: 0.946767572
p_ni: 0.053232428
Data Source: BioPlex
GOLGA4
Tbio
Novelty: 0.0181571
p_int: 0.944341709
p_ni: 0.05565829
p_wrong: 1e-9
Score: 0.187
Data Source: BioPlex,STRINGDB
STMN3
Tbio
Novelty: 0.06646693
p_int: 0.9433447
p_ni: 0.0566553
Data Source: BioPlex
WFDC9
Tdark
Novelty: 6
p_int: 0.927481726
p_ni: 0.072518273
Score: 0.206
Data Source: BioPlex,STRINGDB
GAST
Tbio
Novelty: 0.00012434
p_int: 0.926736422
p_ni: 0.073263577
p_wrong: 1e-9
Data Source: BioPlex
Publication Statistics
PubMed Score  16.79

PubMed score by year
PubTator Score  2.25

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASDTPESLMALCTDFCLRNLDGTLGYLLDKETLRLHPDIFLPSEICDRLVNEYVELVNAACNFEPHESF
1-70
FSLFSDPRSTRLTRIHLREDLVQDQDLEAIRKQDLVELYLTNCEKLSAKSLQTLRSFSHTLVSLSLFGCT
70-140
NIFYEEENPGGCEDEYLVNPTCQVLVKDFTFEGFSRLRFLNLGRMIDWVPVESLLRPLNSLAALDLSGIQ
140-210
TSDAAFLTQWKDSLVSLVLYNMDLSDDHIRVIVQLHKLRHLDISRDRLSSYYKFKLTREVLSLFVQKLGN
210-280
LMSLDISGHMILENCSISKMEEEAGQTSIEPSKSSIIPFRALKRPLQFLGLFENSLCRLTHIPAYKVSGD
280-350
KNEEQVLNAIEAYTEHRPEITSRAINLLFDIARIERCNQLLRALKLVITALKCHKYDRNIQVTGSAALFY
350-420
LTNSEYRSEQSVKLRRQVIQVVLNGMESYQEVTVQRNCCLTLCNFSIPEELEFQYRRVNELLLSILNPTR
420-490
QDESIQRIAVHLCNALVCQVDNDHKEAVGKMGFVVTMLKLIQKKLLDKTCDQVMEFSWSALWNITDETPD
490-560
NCEMFLNFNGMKLFLDCLKEFPEKQELHRNMLGLLGNVAEVKELRPQLMTSQFISVFSNLLESKADGIEV
560-630
SYNACGVLSHIMFDGPEAWGVCEPQREEVEERMWAAIQSWDINSRRNINYRSFEPILRLLPQGISPVSQH
630-700
WATWALYNLVSVYPDKYCPLLIKEGGMPLLRDIIKMATARQETKEMARKVIEHCSNFKEENMDTSR
700-766
MASDTPESLMALCTDFCLRNLDGTLGYLLDKETLRLHPDIFLPSEICDRLVNEYVELVNAACNFEPHESFFSLFSDPRSTRLTRIHLREDLVQDQDLEAIRKQDLVELYLTNCEKLSAKSLQTLRSFSHTLVSLSLFGCTNIFYEEENPGGCEDEYLVNPTCQVLVKDFTFEGFSRLRFLNLGRMIDWVPVESLLRPLNSLAALDLSGIQTSDAAFLTQWKDSLVSLVLYNMDLSDDHIRVIVQLHKLRHLDISRDRLSSYYKFKLTREVLSLFVQKLGNLMSLDISGHMILENCSISKMEEEAGQTSIEPSKSSIIPFRALKRPLQFLGLFENSLCRLTHIPAYKVSGDKNEEQVLNAIEAYTEHRPEITSRAINLLFDIARIERCNQLLRALKLVITALKCHKYDRNIQVTGSAALFYLTNSEYRSEQSVKLRRQVIQVVLNGMESYQEVTVQRNCCLTLCNFSIPEELEFQYRRVNELLLSILNPTRQDESIQRIAVHLCNALVCQVDNDHKEAVGKMGFVVTMLKLIQKKLLDKTCDQVMEFSWSALWNITDETPDNCEMFLNFNGMKLFLDCLKEFPEKQELHRNMLGLLGNVAEVKELRPQLMTSQFISVFSNLLESKADGIEVSYNACGVLSHIMFDGPEAWGVCEPQREEVEERMWAAIQSWDINSRRNINYRSFEPILRLLPQGISPVSQHWATWALYNLVSVYPDKYCPLLIKEGGMPLLRDIIKMATARQETKEMARKVIEHCSNFKEENMDTSR