You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
APBB1IP
Amyloid beta A4 precursor protein-binding family B member 1-interacting protein

Protein Classes
Protein Summary
Description
Appears to function in the signal transduction from Ras activation to actin cytoskeletal remodeling. Suppresses insulin-induced promoter activities through AP1 and SRE. Mediates Rap1-induced adhesion.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000356785
  • ENSP00000349237
  • ENSG00000077420
  • ENST00000376236
  • ENSP00000365411

Symbol
  • PREL1
  • RARP1
  • RIAM
  • RIAM
  • INAG1
  • PREL1
  • RARP1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.79
interacting protein
0.77
tissue sample
0.67
phenotype
0.63
PubMedID
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 41.96   (req: < 5)
Gene RIFs: 13   (req: <= 3)
Antibodies: 201   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 41.96   (req: >= 5)
Gene RIFs: 13   (req: > 3)
Antibodies: 201   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (32)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 25
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Disease
Reactome
Diseases of signal transduction
Reactome
FLT3 Signaling
Reactome
GRB2:SOS provides linkage to MAPK signaling for Integrins
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Disease
Diseases of signal transduction
FLT3 Signaling
GRB2:SOS provides linkage to MAPK signaling for Integrins
Gene Ontology Terms (9)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
HPA
Inferred from Direct Assay (IDA)
HPA
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (138)
1 – 10 of 138
PLEKHH1
Tdark
Novelty: 1.875
p_int: 0.999999618
p_ni: 3.81e-7
p_wrong: 1e-9
Score: 0.685
Data Source: BioPlex,STRINGDB
ANXA13
Tbio
Novelty: 0.0274429
p_int: 0.99997282
p_ni: 0.000023996
p_wrong: 0.000003184
Score: 0.519
Data Source: BioPlex,STRINGDB
TLN1
Tbio
Novelty: 0.00988479
Score: 0.993
Data Source: Reactome,STRINGDB
RAP1A
Tchem
Family: Enzyme
Novelty: 0.00466391
Score: 0.991
Data Source: Reactome,STRINGDB
RAP1B
Tbio
Family: Enzyme
Novelty: 0.00195699
Score: 0.982
Data Source: Reactome,STRINGDB
TLN2
Tbio
Novelty: 0.0383066
Score: 0.978
Data Source: STRINGDB
VCL
Tbio
Novelty: 0.00044707
Score: 0.955
Data Source: Reactome,STRINGDB
VASP
Tbio
Novelty: 0.00096602
Score: 0.948
Data Source: STRINGDB
SRC
Tclin
Family: Kinase
Novelty: 0.00009742
Score: 0.941
Data Source: Reactome,STRINGDB
FN1
Tchem
Novelty: 0.0000437
Score: 0.932
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  41.96

PubMed score by year
PubTator Score  25.56

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMAD
1-70
LVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLP
70-140
LPPPPPEPLSQEEEEAQAKADKIKLALEKLKEAKVKKLVVKVHMNDNSTKSLMVDERQLARDVLDNLFEK
140-210
THCDCNVDWCLYEIYPELQIERFFEDHENVVEVLSDWTRDTENKILFLEKEEKYAVFKNPQNFYLDNRGK
210-280
KESKETNEKMNAKNKESLLEESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTS
280-350
RDLACFIQFENVNIYYGTQHKMKYKAPTDYCFVLKHPQIQKESQYIKYLCCDDTRTLNQWVMGIRIAKYG
350-420
KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETS
420-490
KDKKPALGNHHDPAVPRAPHAPKSSLPPPPPVRRSSDTSGSPATPLKAKGTGGGGLPAPPDDFLPPPPPP
490-560
PPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPPAPAPAPVPDSARPPPAVAKRPPVP
560-630
PKRQENPGHPGGAGGGEQDFMSDLMKALQKKRGNVS
630-666
MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLPLPPPPPEPLSQEEEEAQAKADKIKLALEKLKEAKVKKLVVKVHMNDNSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIERFFEDHENVVEVLSDWTRDTENKILFLEKEEKYAVFKNPQNFYLDNRGKKESKETNEKMNAKNKESLLEESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFENVNIYYGTQHKMKYKAPTDYCFVLKHPQIQKESQYIKYLCCDDTRTLNQWVMGIRIAKYGKTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETSKDKKPALGNHHDPAVPRAPHAPKSSLPPPPPVRRSSDTSGSPATPLKAKGTGGGGLPAPPDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPPAPAPAPVPDSARPPPAVAKRPPVPPKRQENPGHPGGAGGGEQDFMSDLMKALQKKRGNVS