You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
HSD11B1L
Hydroxysteroid 11-beta-dehydrogenase 1-like protein

Protein Summary
Description
This gene is a member of the hydroxysteroid dehydrogenase family. The encoded protein is similar to an enzyme that catalyzes the interconversion of inactive to active glucocorticoids (e.g. cortisone). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jun 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000301382
  • ENSP00000301382
  • ENSG00000167733
  • ENST00000339423
  • ENSP00000340436
  • ENST00000342970
  • ENSP00000343451
  • ENST00000411793
  • ENSP00000398955
  • ENST00000422535
  • ENSP00000409592
  • ENST00000423665
  • ENSP00000407154
  • ENST00000577917
  • ENSP00000463073
  • ENST00000581521
  • ENSP00000463794
  • ENST00000581773
  • ENSP00000462975
  • ENST00000581893
  • ENSP00000464454
  • ENST00000583928
  • ENSP00000462586

Symbol
  • HSD3
  • SCDR10
  • SDR26C2
  • HSD3
  • HSD1L
  • 11-DH3
  • SCDR10
  • SCDR10B
  • SDR26C2
  • 11-beta-HSD3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.69
protein domain
0.58
cell type or tissue
0.56
tissue sample
0.54
virus perturbation
0.5


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.99   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 101   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.99   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 101   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (4)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (14)
1 – 10 of 14
LONP1
Tbio
Family: Enzyme
Novelty: 0.00502512
Score: 0.559
Data Source: STRINGDB
PPP2R1B
Tbio
Family: Enzyme
Novelty: 0.06111104
Score: 0.5
Data Source: STRINGDB
PPP3R1
Tbio
Novelty: 0.00213192
Score: 0.477
Data Source: STRINGDB
MFSD3
Tdark
Novelty: 2.35714286
Score: 0.471
Data Source: STRINGDB
DYSF
Tbio
Novelty: 0.0026878
Score: 0.467
Data Source: STRINGDB
ROGDI
Tbio
Novelty: 0.07032696
Score: 0.452
Data Source: STRINGDB
KLF13
Tbio
Family: TF
Novelty: 0.03163397
Score: 0.439
Data Source: STRINGDB
STEAP3
Tbio
Family: Enzyme
Novelty: 0.0328697
Score: 0.43
Data Source: STRINGDB
CCDC3
Tbio
Novelty: 0.16632017
Score: 0.424
Data Source: STRINGDB
ABHD4
Tdark
Family: Enzyme
Novelty: 0.28270137
Score: 0.421
Data Source: STRINGDB
Publication Statistics
PubMed Score  3.99

PubMed score by year
PubTator Score  26.47

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKVLLLTGLGALFFAYYWDDNFDPASLQGARVLLTGANAGVGEELAYHYARLGSHLVLTAHTEALLQKVV
1-70
GNCRKLGAPKVFYIAADMASPEAPESVVQFALDKLGGLDYLVLNHIGGAPAGTRARSPQATRWLMQVNFV
70-140
SYVQLTSRALPSLTDSKGSLVVVSSLLGRVPTSFSTPYSAAKFALDGFFGSLRRELDVQDVNVAITMCVL
140-210
GLRDRASAAEAVRSSTSRPRQPEHRGVPLQSQTAMFLPPTVPGARTLTETPLRGWPQPKMKSSRQKSKTE
210-280
KNDGHLEPVTAWEVQVPRVRRLCRGLARPHLFGHD
280-315
MKVLLLTGLGALFFAYYWDDNFDPASLQGARVLLTGANAGVGEELAYHYARLGSHLVLTAHTEALLQKVVGNCRKLGAPKVFYIAADMASPEAPESVVQFALDKLGGLDYLVLNHIGGAPAGTRARSPQATRWLMQVNFVSYVQLTSRALPSLTDSKGSLVVVSSLLGRVPTSFSTPYSAAKFALDGFFGSLRRELDVQDVNVAITMCVLGLRDRASAAEAVRSSTSRPRQPEHRGVPLQSQTAMFLPPTVPGARTLTETPLRGWPQPKMKSSRQKSKTEKNDGHLEPVTAWEVQVPRVRRLCRGLARPHLFGHD