You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
SLC46A3
Solute carrier family 46 member 3

Protein Summary
Description
The protein encoded by this gene is a member of a transmembrane protein family that transports small molecules across membranes. The encoded protein has been found in lysosomal membranes, where it can transport catabolites from the lysosomes to the cytoplasm. This protein has been shown to be an effective transporter of the cytotoxic drug maytansine, which is used in antibody-based targeting of cancer cells. [provided by RefSeq, Dec 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000266943
  • ENSP00000266943
  • ENSG00000139508
  • ENST00000380814
  • ENSP00000370192

Symbol
  • FKSG16
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
0.98
transcription factor perturbation
0.88
virus perturbation
0.85
microRNA
0.73
transcription factor binding site profile
0.72


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.92   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 55   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.92   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 55   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (3)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (31)
1 – 10 of 31
ADGRG3
Tchem
Family: GPCR
Novelty: 0.12992476
Score: 0.696
Data Source: STRINGDB
SLC29A3
Tbio
Family: Transporter
Novelty: 0.00456471
Score: 0.689
Data Source: STRINGDB
MFSD4B
Tdark
Novelty: 0.04720546
Score: 0.686
Data Source: STRINGDB
SLC29A4
Tchem
Family: Transporter
Novelty: 0.01162241
Score: 0.686
Data Source: STRINGDB
MFSD14A
Tbio
Novelty: 0.12121212
Score: 0.681
Data Source: STRINGDB
MFSD10
Tbio
Novelty: 0.00649456
Score: 0.673
Data Source: STRINGDB
SLC25A32
Tbio
Family: Transporter
Novelty: 0.0404398
Score: 0.603
Data Source: STRINGDB
HDHD3
Tdark
Family: Enzyme
Novelty: 2.25
Score: 0.598
Data Source: STRINGDB
SLC29A1
Tclin
Family: Transporter
Novelty: 0.00231179
Score: 0.576
Data Source: STRINGDB
TMEM217
Tdark
Novelty: 2.60526316
Score: 0.565
Data Source: STRINGDB
Publication Statistics
PubMed Score  1.92

PubMed score by year
PubTator Score  1.6

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKILFVEPAIFLSAFAMTLTGPLTTQYVYRRIWEETGNYTFSSDSNISECEKNKSSPIFAFQEEVQKKVS
1-70
RFNLQMDISGLIPGLVSTFILLSISDHYGRKFPMILSSVGALATSVWLCLLCYFAFPFQLLIASTFIGAF
70-140
CGNYTTFWGACFAYIVDQCKEHKQKTIRIAIIDFLLGLVTGLTGLSSGYFIRELGFEWSFLIIAVSLAVN
140-210
LIYILFFLGDPVKECSSQNVTMSCSEGFKNLFYRTYMLFKNASGKRRFLLCLLLFTVITYFFVVIGIAPI
210-280
FILYELDSPLCWNEVFIGYGSALGSASFLTSFLGIWLFSYCMEDIHMAFIGIFTTMTGMAMTAFASTTLM
280-350
MFLARVPFLFTIVPFSVLRSMLSKVVRSTEQGTLFACIAFLETLGGVTAVSTFNGIYSATVAWYPGFTFL
350-420
LSAGLLLLPAISLCVVKCTSWNEGSYELLIQEESSEDASDR
420-461
MKILFVEPAIFLSAFAMTLTGPLTTQYVYRRIWEETGNYTFSSDSNISECEKNKSSPIFAFQEEVQKKVSRFNLQMDISGLIPGLVSTFILLSISDHYGRKFPMILSSVGALATSVWLCLLCYFAFPFQLLIASTFIGAFCGNYTTFWGACFAYIVDQCKEHKQKTIRIAIIDFLLGLVTGLTGLSSGYFIRELGFEWSFLIIAVSLAVNLIYILFFLGDPVKECSSQNVTMSCSEGFKNLFYRTYMLFKNASGKRRFLLCLLLFTVITYFFVVIGIAPIFILYELDSPLCWNEVFIGYGSALGSASFLTSFLGIWLFSYCMEDIHMAFIGIFTTMTGMAMTAFASTTLMMFLARVPFLFTIVPFSVLRSMLSKVVRSTEQGTLFACIAFLETLGGVTAVSTFNGIYSATVAWYPGFTFLLSAGLLLLPAISLCVVKCTSWNEGSYELLIQEESSEDASDR