You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
DGLUCY
D-glutamate cyclase, mitochondrial

Protein Summary
Description
D-glutamate cyclase that converts D-glutamate to 5-oxo-D-proline.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000256324
  • ENSP00000256324
  • ENSG00000133943
  • ENST00000298858
  • ENSP00000298858
  • ENST00000412671
  • ENSP00000404196
  • ENST00000428926
  • ENSP00000404343
  • ENST00000518665
  • ENSP00000429098
  • ENST00000518868
  • ENSP00000428263
  • ENST00000520328
  • ENSP00000429453
  • ENST00000521077
  • ENSP00000430137
  • ENST00000522322
  • ENSP00000427953
  • ENST00000523771
  • ENSP00000429655
  • ENST00000523816
  • ENSP00000428974
  • ENST00000525393
  • ENSP00000435459

Symbol
  • C14orf159
  • C14orf159
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.63   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 29   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.63   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 29   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (3)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Protein-Protein Interactions (29)
1 – 10 of 29
GLS2
Tbio
Family: Enzyme
Novelty: 0.00145737
Score: 0.9
Data Source: STRINGDB
GLS
Tchem
Family: Enzyme
Novelty: 0.00104556
Score: 0.9
Data Source: STRINGDB
C15orf40
Tdark
Score: 0.669
Data Source: STRINGDB
OPLAH
Tbio
Family: Enzyme
Novelty: 0.02787364
Score: 0.6
Data Source: STRINGDB
LRRN4CL
Tdark
Score: 0.589
Data Source: STRINGDB
TRAPPC10
Tbio
Novelty: 0.0429625
Score: 0.577
Data Source: STRINGDB
C8orf82
Tdark
Score: 0.57
Data Source: STRINGDB
RC3H1
Tbio
Novelty: 0.02668926
Score: 0.548
Data Source: STRINGDB
PSMB4
Tbio
Family: Enzyme
Novelty: 0.06608783
Score: 0.533
Data Source: STRINGDB
PQLC3
Tdark
Score: 0.525
Data Source: STRINGDB
Publication Statistics
PubMed Score  1.63

PubMed score by year
PubTator Score  0.17

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPFTLHLRSRLPSAIRSLILQKKPNIRNTSSMAGELRPASLVVLPRSLAPAFERFCQVNTGPLPLLGQSE
1-70
PEKWMLPPQGAISETRMGHPQFWKYEFGACTGSLASLEQYSEQLKDMVAFFLGCSFSLEEALEKAGLPRR
70-140
DPAGHSQTTVPCVTHAGFCCPLVVTMRPIPKDKLEGLVRACCSLGGEQGQPVHMGDPELLGIKELSKPAY
140-210
GDAMVCPPGEVPVFWPSPLTSLGAVSSCETPLAFASIPGCTVMTDLKDAKAPPGCLTPERIPEVHHISQD
210-280
PLHYSIASVSASQKIRELESMIGIDPGNRGIGHLLCKDELLKASLSLSHARSVLITTGFPTHFNHEPPEE
280-350
TDGPPGAVALVAFLQALEKEVAIIVDQRAWNLHQKIVEDAVEQGVLKTQIPILTYQGGSVEAAQAFLCKN
350-420
GDPQTPRFDHLVAIERAGRAADGNYYNARKMNIKHLVDPIDDLFLAAKKIPGISSTGVGDGGNELGMGKV
420-490
KEAVRRHIRHGDVIACDVEADFAVIAGVSNWGGYALACALYILYSCAVHSQYLRKAVGPSRAPGDQAWTQ
490-560
ALPSVIKEEKMLGILVQHKVRSGVSGIVGMEVDGLPFHNTHAEMIQKLVDVTTAQV
560-616
MPFTLHLRSRLPSAIRSLILQKKPNIRNTSSMAGELRPASLVVLPRSLAPAFERFCQVNTGPLPLLGQSEPEKWMLPPQGAISETRMGHPQFWKYEFGACTGSLASLEQYSEQLKDMVAFFLGCSFSLEEALEKAGLPRRDPAGHSQTTVPCVTHAGFCCPLVVTMRPIPKDKLEGLVRACCSLGGEQGQPVHMGDPELLGIKELSKPAYGDAMVCPPGEVPVFWPSPLTSLGAVSSCETPLAFASIPGCTVMTDLKDAKAPPGCLTPERIPEVHHISQDPLHYSIASVSASQKIRELESMIGIDPGNRGIGHLLCKDELLKASLSLSHARSVLITTGFPTHFNHEPPEETDGPPGAVALVAFLQALEKEVAIIVDQRAWNLHQKIVEDAVEQGVLKTQIPILTYQGGSVEAAQAFLCKNGDPQTPRFDHLVAIERAGRAADGNYYNARKMNIKHLVDPIDDLFLAAKKIPGISSTGVGDGGNELGMGKVKEAVRRHIRHGDVIACDVEADFAVIAGVSNWGGYALACALYILYSCAVHSQYLRKAVGPSRAPGDQAWTQALPSVIKEEKMLGILVQHKVRSGVSGIVGMEVDGLPFHNTHAEMIQKLVDVTTAQV