You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PID1
PTB-containing, cubilin and LRP1-interacting protein

Protein Summary
Description
Increases proliferation of preadipocytes without affecting adipocytic differentiation.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000354069
  • ENSP00000283937
  • ENSG00000153823
  • ENST00000392054
  • ENSP00000375907
  • ENST00000392055
  • ENSP00000375908
  • ENST00000409462
  • ENSP00000386826

Symbol
  • NYGGF4
  • PCLI1
  • PCLI1
  • NYGGF4
  • P-CLI1
  • HMFN2073
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.98
trait
0.86
transcription factor perturbation
0.74
disease perturbation
0.68
tissue sample
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 65.6   (req: < 5)
Gene RIFs: 11   (req: <= 3)
Antibodies: 113   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 65.6   (req: >= 5)
Gene RIFs: 11   (req: > 3)
Antibodies: 113   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 20
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (21)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Protein-Protein Interactions (40)
1 – 10 of 40
SCRN3
Tbio
Family: Enzyme
Novelty: 0.05240175
p_int: 0.999327317
p_ni: 0.000253434
p_wrong: 0.000419249
Data Source: BioPlex
RIPK4
Tchem
Family: Kinase
Novelty: 0.00970161
p_int: 0.997750286
p_ni: 0.002094156
p_wrong: 0.000155558
Data Source: BioPlex
LRPAP1
Tbio
Novelty: 0.0018518
p_int: 0.897620317
p_ni: 0.102379683
Data Source: BioPlex
LRP1
Tbio
Novelty: 0.00117899
p_int: 0.801940944
p_ni: 0.198059056
Score: 0.513
Data Source: BioPlex,STRINGDB
NTM
Tbio
Novelty: 0.01681974
Score: 0.657
Data Source: STRINGDB
HSF4
Tbio
Family: TF
Novelty: 0.0191818
Score: 0.641
Data Source: STRINGDB
MFGE8
Tbio
Novelty: 0.00173389
Score: 0.621
Data Source: STRINGDB
FAM13A
Tbio
Novelty: 0.03546622
Score: 0.594
Data Source: STRINGDB
GSTCD
Tbio
Family: Enzyme
Novelty: 0.19076326
Score: 0.57
Data Source: STRINGDB
THSD4
Tbio
Novelty: 0.16828393
Score: 0.56
Data Source: STRINGDB
Publication Statistics
PubMed Score  65.60

PubMed score by year
PubTator Score  29.17

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MFSLPLSLPLCEDTAFLPSKCCSSHKTIKQARTLIMIFLASGTHFQTMLKSKLNVLTLKKEPLPAVIFHE
1-70
PEAIELCTTTPLMKTRTHSGCKVTYLGKVSTTGMQFLSGCTEKPVIELWKKHTLAREDVFPANALLEIRP
70-140
FQVWLHHLDHKGEATVHMDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKK
140-210
LAHAMMEAFRKTFHSMKSDGRIHSNSSSEEVSQELESDDG
210-250
MFSLPLSLPLCEDTAFLPSKCCSSHKTIKQARTLIMIFLASGTHFQTMLKSKLNVLTLKKEPLPAVIFHEPEAIELCTTTPLMKTRTHSGCKVTYLGKVSTTGMQFLSGCTEKPVIELWKKHTLAREDVFPANALLEIRPFQVWLHHLDHKGEATVHMDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFRKTFHSMKSDGRIHSNSSSEEVSQELESDDG