You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RASGRP2
RAS guanyl-releasing protein 2

Protein Summary
Description
Functions as a calcium- and DAG-regulated nucleotide exchange factor specifically activating Rap through the exchange of bound GDP for GTP. May also activates other GTPases such as RRAS, RRAS2, NRAS, KRAS but not HRAS. Functions in aggregation of platelets and adhesion of T-lymphocytes and neutrophils probably through inside-out integrin activation. May function in the muscarinic acetylcholine receptor M1/CHRM1 signaling pathway. The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain. This protein can activate small GTPases, including RAS and RAP1/RAS3. The nucleotide exchange activity of this protein can be stimulated by calcium and diacylglycerol. Four alternatively spliced transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jan 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000354024
  • ENSP00000338864
  • ENSG00000068831
  • ENST00000377494
  • ENSP00000366714
  • ENST00000377497
  • ENSP00000366717
  • ENST00000394432
  • ENSP00000377953

Symbol
  • CDC25L
  • MCG7
  • CDC25L
  • CALDAG-GEFI
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.93
protein domain
0.92
PubMedID
0.87
metabolite
0.82
transcription factor
0.8


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 42.42   (req: < 5)
Gene RIFs: 11   (req: <= 3)
Antibodies: 128   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 42.42   (req: >= 5)
Gene RIFs: 11   (req: > 3)
Antibodies: 128   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (440)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 16
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Effects of PIP2 hydrolysis
Reactome
FCERI mediated NF-kB activation
Reactome
Fc epsilon receptor (FCERI) signaling
Reactome
G alpha (q) signalling events
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Effects of PIP2 hydrolysis
FCERI mediated NF-kB activation
Fc epsilon receptor (FCERI) signaling
G alpha (q) signalling events
Protein-Protein Interactions (78)
1 – 10 of 78
RAP1A
Tchem
Family: Enzyme
Novelty: 0.00466391
Score: 0.983
Data Source: Reactome,STRINGDB
RAP1B
Tbio
Family: Enzyme
Novelty: 0.00195699
Score: 0.972
Data Source: Reactome,STRINGDB
KRAS
Tchem
Family: Enzyme
Novelty: 0.00018907
Score: 0.959
Data Source: STRINGDB
NRAS
Tchem
Family: Enzyme
Novelty: 0.00085585
Score: 0.954
Data Source: STRINGDB
RRAS
Tbio
Family: Enzyme
Novelty: 0.00229703
Score: 0.947
Data Source: STRINGDB
ITPR1
Tchem
Family: IC
Novelty: 0.00160922
Score: 0.909
Data Source: STRINGDB
ITPR3
Tchem
Family: IC
Novelty: 0.00274855
Score: 0.909
Data Source: STRINGDB
RASGRP1
Tchem
Novelty: 0.00919644
Score: 0.908
Data Source: STRINGDB
ITPR2
Tbio
Family: IC
Novelty: 0.0094474
Score: 0.906
Data Source: STRINGDB
HRAS
Tchem
Family: Enzyme
Novelty: 0.00008788
Score: 0.782
Data Source: STRINGDB
Publication Statistics
PubMed Score  42.42

PubMed score by year
PubTator Score  21.15

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNS
1-70
LQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIDSVPTYKWKRQVTQRNPVG
70-140
QKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHSFVTHGCTVDNPVLERFISLFNSVSQWVQLM
140-210
ILSKPTAPQRALVITHFVHVAEKLLQLQNFNTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELV
210-280
TATGNYGNYRRRLAACVGFRFPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSL
280-350
RPPVQANPDLLSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQ
350-420
ALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEMVSYFLRSSSV
420-490
LGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCKDRLSVECRRRAQSVSLEGS
490-560
APSPSPMHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTVEDGVFDIHL
560-609
MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIDSVPTYKWKRQVTQRNPVGQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHSFVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRALVITHFVHVAEKLLQLQNFNTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAACVGFRFPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDLLSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEMVSYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCKDRLSVECRRRAQSVSLEGSAPSPSPMHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTVEDGVFDIHL