You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MOB1B
MOB kinase activator 1B

Protein Summary
Description
Activator of LATS1/2 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Stimulates the kinase activity of STK38L. The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000309395
  • ENSP00000310189
  • ENSG00000173542
  • ENST00000396051
  • ENSP00000379366

Symbol
  • MOB4A
  • MOBKL1A
  • MATS2
  • MOB4A
  • MOBKL1A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.84
microRNA
0.76
interacting protein
0.75
histone modification site profile
0.71
virus perturbation
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.98   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 332   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.98   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 332   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (10)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (61)
1 – 10 of 61
LATS1
Tbio
Family: Kinase
Novelty: 0.00433613
p_int: 1
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
LATS2
Tchem
Family: Kinase
Novelty: 0.00277994
p_int: 1
Score: 0.997
Data Source: BioPlex,Reactome,STRINGDB
MOB1A
Tbio
Family: Enzyme
Novelty: 0.0429382
p_int: 1
Score: 0.985
Data Source: BioPlex,STRINGDB
STK38L
Tchem
Family: Kinase
Novelty: 0.054716
p_int: 1
Score: 0.969
Data Source: BioPlex,STRINGDB
STK38
Tbio
Family: Kinase
Novelty: 0.04129184
p_int: 0.999999446
p_ni: 5.52e-7
p_wrong: 1e-9
Score: 0.895
Data Source: BioPlex,STRINGDB
LRCH2
Tdark
p_int: 0.999762932
p_ni: 0.000237068
Score: 0.229
Data Source: BioPlex,STRINGDB
DOCK7
Tbio
Novelty: 0.05517795
p_int: 0.999698368
p_ni: 0.000301632
Score: 0.343
Data Source: BioPlex,STRINGDB
STK4
Tchem
Family: Kinase
Novelty: 0.02467485
Score: 0.995
Data Source: Reactome,STRINGDB
STK3
Tchem
Family: Kinase
Novelty: 0.09293063
Score: 0.993
Data Source: Reactome,STRINGDB
SAV1
Tbio
Novelty: 0.01342169
Score: 0.981
Data Source: STRINGDB
Publication Statistics
PubMed Score  4.98

PubMed score by year
PubTator Score  2.49

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINM
1-70
LYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPF
70-140
PKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEK
140-210
LTSKDR
210-216
MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR