You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
GDPD3
Lysophospholipase D GDPD3

Protein Summary
Description
Hydrolyzes lysoglycerophospholipids to produce lysophosphatidic acid (LPA) and the corresponding amines. Shows a preference for 1-O-alkyl-sn-glycero-3-phosphocholine (lyso-PAF) and lysophosphatidylcholine (lyso-PC), and to a lesser extent for lysophosphatidylethanolamine (lyso-PE). Does not display glycerophosphodiester phosphodiesterase activity, since it cannot hydrolyze either glycerophosphoinositol or glycerophosphocholine.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000406256
  • ENSP00000384363
  • ENSG00000102886

Symbol
  • GDE7
  • GDE7
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.98
disease
0.93
disease perturbation
0.56
tissue
0.56
cell line
0.52


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.6   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 101   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.6   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 101   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (6)
Glycerophospholipid catabolism (R-HSA-6814848)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Glycerophospholipid catabolism
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
PI Metabolism
Reactome
Phospholipid metabolism
Name
Explore in Pharos
Explore in Source
Glycerophospholipid catabolism
Metabolism
Metabolism of lipids
PI Metabolism
Phospholipid metabolism
Gene Ontology Terms (7)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (77)
1 – 10 of 77
ZIC1
Tbio
Family: TF
Novelty: 0.00309271
p_int: 0.999887566
p_ni: 0.000112428
p_wrong: 6e-9
Data Source: BioPlex
NPPA
Tchem
Novelty: 0.00054421
p_int: 0.999385702
p_ni: 0.000455044
p_wrong: 0.000159254
Score: 0.179
Data Source: BioPlex,STRINGDB
CCDC103
Tbio
Novelty: 0.007955
p_int: 0.999375347
p_ni: 0.000599377
p_wrong: 0.000025276
Data Source: BioPlex
AIRE
Tbio
Family: TF; Epigenetic
Novelty: 0.00109835
p_int: 0.998240073
p_ni: 0.001046736
p_wrong: 0.00071319
Score: 0.194
Data Source: BioPlex,STRINGDB
PDE4DIP
Tbio
Novelty: 0.04181178
p_int: 0.793015202
p_ni: 0.008401303
p_wrong: 0.198583495
Data Source: BioPlex
ENPP6
Tbio
Family: Enzyme
Novelty: 0.104096
Score: 0.906
Data Source: STRINGDB
TMEM86B
Tbio
Family: Enzyme
Novelty: 0.23076923
Score: 0.906
Data Source: STRINGDB
LPCAT4
Tdark
Family: Enzyme
Novelty: 0.22556391
Score: 0.905
Data Source: STRINGDB
ENPP2
Tchem
Family: Enzyme
Novelty: 0.00213072
Score: 0.848
Data Source: STRINGDB
GDPD1
Tbio
Family: Enzyme
Novelty: 0.1910828
Score: 0.819
Data Source: STRINGDB
Publication Statistics
PubMed Score  4.60

PubMed score by year
PubTator Score  3.18

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSLLLYYALPALGSYAMLSIFFLRRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAMENSMAQRSDLL
1-70
ELDCQLTRDRVVVVSHDENLCRQSGLNRDVGSLDFEDLPLYKEKLEVYFSPGHFAHGSDRRMVRLEDLFQ
70-140
RFPRTPMSVEIKGKNEELIREIAGLVRRYDRNEITIWASEKSSVMKKCKAANPEMPLSFTISRGFWVLLS
140-210
YYLGLLPFIPIPEKFFFCFLPNIINRTYFPFSCSCLNQLLAVVSKWLIMRKSLIRHLEERGVQVVFWCLN
210-280
EESDFEAAFSVGATGVITDYPTALRHYLDNHGPAARTS
280-318
MSLLLYYALPALGSYAMLSIFFLRRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAMENSMAQRSDLLELDCQLTRDRVVVVSHDENLCRQSGLNRDVGSLDFEDLPLYKEKLEVYFSPGHFAHGSDRRMVRLEDLFQRFPRTPMSVEIKGKNEELIREIAGLVRRYDRNEITIWASEKSSVMKKCKAANPEMPLSFTISRGFWVLLSYYLGLLPFIPIPEKFFFCFLPNIINRTYFPFSCSCLNQLLAVVSKWLIMRKSLIRHLEERGVQVVFWCLNEESDFEAAFSVGATGVITDYPTALRHYLDNHGPAARTS