You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MCM10
Protein MCM10 homolog

Protein Summary
Description
Acts as a replication initiation factor that brings together the MCM2-7 helicase and the DNA polymerase alpha/primase complex in order to initiate DNA replication. Additionally, plays a role in preventing DNA damage during replication. Key effector of the RBBP6 and ZBTB38-mediated regulation of DNA-replication and common fragile sites stability; acts as a direct target of transcriptional repression by ZBTB38 (PubMed:24726359). The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre-RC) and it may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein can interact with MCM2 and MCM6, as well as with the origin recognition protein ORC2. It is regulated by proteolysis and phosphorylation in ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000378714
  • ENSP00000367986
  • ENSG00000065328
  • ENST00000484800
  • ENSP00000418268

Symbol
  • CNA43
  • DNA43
  • PRO2249
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.96
kinase perturbation
0.88
histone modification site profile
0.87
gene perturbation
0.84
small molecule perturbation
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 61.31   (req: < 5)
Gene RIFs: 24   (req: <= 3)
Antibodies: 137   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 61.31   (req: >= 5)
Gene RIFs: 24   (req: > 3)
Antibodies: 137   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (12)
Activation of ATR in response to replication stress (R-HSA-176187)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of ATR in response to replication stress
Reactome
Activation of the pre-replicative complex
Reactome
Cell Cycle
Reactome
Cell Cycle Checkpoints
Reactome
Cell Cycle, Mitotic
Name
Explore in Pharos
Explore in Source
Activation of ATR in response to replication stress
Activation of the pre-replicative complex
Cell Cycle
Cell Cycle Checkpoints
Cell Cycle, Mitotic
Gene Ontology Terms (15)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (257)
1 – 10 of 257
DISC1
Tbio
Novelty: 0.00165188
p_int: 0.999981355
p_ni: 0.000018645
Data Source: BioPlex
IKZF5
Tbio
Family: TF
Novelty: 1
p_int: 0.999968429
p_ni: 0.000031571
Data Source: BioPlex
CAV3
Tbio
Novelty: 0.00250765
p_int: 0.999946879
p_ni: 0.000053121
Data Source: BioPlex
KLHL40
Tbio
Novelty: 0.0554492
p_int: 0.999918908
p_ni: 0.000081092
p_wrong: 1e-9
Score: 0.305
Data Source: BioPlex,STRINGDB
TMEM171
Tdark
Novelty: 5.91917098
p_int: 0.999912572
p_ni: 0.000087428
Score: 0.257
Data Source: BioPlex,STRINGDB
TPH1
Tclin
Family: Enzyme
Novelty: 0.0010885
p_int: 0.999733412
p_ni: 0.000266588
Score: 0.254
Data Source: BioPlex,STRINGDB
RELL2
Tbio
Novelty: 0.65217391
p_int: 0.999643526
p_ni: 0.000356473
p_wrong: 1e-9
Data Source: BioPlex
CACNG5
Tdark
Family: IC
Novelty: 0.81553398
p_int: 0.998139955
p_ni: 0.001860045
Data Source: BioPlex
EVA1B
Tdark
Novelty: 3
p_int: 0.994727124
p_ni: 0.005272605
p_wrong: 2.71e-7
Data Source: BioPlex
MICB
Tbio
Novelty: 0.00776922
p_int: 0.991919494
p_ni: 0.008080044
p_wrong: 4.61e-7
Data Source: BioPlex
Publication Statistics
PubMed Score  61.31

PubMed score by year
PubTator Score  37.05

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDEEEDNLSLLTALLEENESALDCNSEENNFLTRENGEPDAFDELFDADGDGESYTEEADDGETGETRDE
1-70
KENLATLFGDMEDLTDEEEVPASQSTENRVLPAPAPRREKTNEELQEELRNLQEQMKALQEQLKVTTIKQ
70-140
TASPARLQKSPVEKSPRPPLKERRVQRIQESTCFSAELDVPALPRTKRVARTPKASPPDPKSSSSRMTSA
140-210
PSQPLQTISRNKPSGITRGQIVGTPGSSGETTQPICVEAFSGLRLRRPRVSSTEMNKKMTGRKLIRLSQI
210-280
KEKMAREKLEEIDWVTFGVILKKVTPQSVNSGKTFSIWKLNDLRDLTQCVSLFLFGEVHKALWKTEQGTV
280-350
VGILNANPMKPKDGSEEVCLSIDHPQKVLIMGEALDLGTCKAKKKNGEPCTQTVNLRDCEYCQYHVQAQY
350-420
KKLSAKRADLQSTFSGGRIPKKFARRGTSLKERLCQDGFYYGGVSSASYAASIAAAVAPKKKIQTTLSNL
420-490
VVKGTNLIIQETRQKLGIPQKSLSCSEEFKELMDLPTCGARNLKQHLAKATASGIMGSPKPAIKSISASA
490-560
LLKQQKQRMLEMRRRKSEEIQKRFLQSSSEVESPAVPSSSRQPPAQPPRTGSEFPRLEGAPATMTPKLGR
560-630
GVLEGDDVLFYDESPPPRPKLSALAEAKKLAAITKLRAKGQVLTKTNPNSIKKKQKDPQDILEVKERVEK
630-700
NTMFSSQAEDELEPARKKRREQLAYLESEEFQKILKAKSKHTGILKEAEAEMQERYFEPLVKKEQMEEKM
700-770
RNIREVKCRVVTCKTCAYTHFKLLETCVSEQHEYHWHDGVKRFFKCPCGNRSISLDRLPNKHCSNCGLYK
770-840
WERDGMLKEKTGPKIGGETLLPRGEEHAKFLNSLK
840-875
MDEEEDNLSLLTALLEENESALDCNSEENNFLTRENGEPDAFDELFDADGDGESYTEEADDGETGETRDEKENLATLFGDMEDLTDEEEVPASQSTENRVLPAPAPRREKTNEELQEELRNLQEQMKALQEQLKVTTIKQTASPARLQKSPVEKSPRPPLKERRVQRIQESTCFSAELDVPALPRTKRVARTPKASPPDPKSSSSRMTSAPSQPLQTISRNKPSGITRGQIVGTPGSSGETTQPICVEAFSGLRLRRPRVSSTEMNKKMTGRKLIRLSQIKEKMAREKLEEIDWVTFGVILKKVTPQSVNSGKTFSIWKLNDLRDLTQCVSLFLFGEVHKALWKTEQGTVVGILNANPMKPKDGSEEVCLSIDHPQKVLIMGEALDLGTCKAKKKNGEPCTQTVNLRDCEYCQYHVQAQYKKLSAKRADLQSTFSGGRIPKKFARRGTSLKERLCQDGFYYGGVSSASYAASIAAAVAPKKKIQTTLSNLVVKGTNLIIQETRQKLGIPQKSLSCSEEFKELMDLPTCGARNLKQHLAKATASGIMGSPKPAIKSISASALLKQQKQRMLEMRRRKSEEIQKRFLQSSSEVESPAVPSSSRQPPAQPPRTGSEFPRLEGAPATMTPKLGRGVLEGDDVLFYDESPPPRPKLSALAEAKKLAAITKLRAKGQVLTKTNPNSIKKKQKDPQDILEVKERVEKNTMFSSQAEDELEPARKKRREQLAYLESEEFQKILKAKSKHTGILKEAEAEMQERYFEPLVKKEQMEEKMRNIREVKCRVVTCKTCAYTHFKLLETCVSEQHEYHWHDGVKRFFKCPCGNRSISLDRLPNKHCSNCGLYKWERDGMLKEKTGPKIGGETLLPRGEEHAKFLNSLK