You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
HTR3D
5-hydroxytryptamine receptor 3D

Protein Summary
Description
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel. The protein encoded this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit D of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a mitogen and a hormone. This hormone has been linked to neuropsychiatric disorders, including anxiety, depression, and migraine. Serotonin receptors causes fast and depolarizing responses in neurons following activation. The genes encoding subunits C, D and E of this type 3 receptor form a cluster on chromosome 3. Alternatively spliced transcript variants encoding different isoforms have been found for this gene ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000382489
  • ENSP00000371929
  • ENSG00000186090
  • ENST00000428798
  • ENSP00000405409
  • ENST00000453435
  • ENSP00000389268

Symbol
  • 5HT3D
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.76
phenotype
0.62
protein domain
0.58
cell line
0.47
disease
0.47


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.71   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 44   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.71   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 44   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Pathways (5)
Neuronal System (R-HSA-112316)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Neuronal System
Reactome
Neurotransmitter receptors and postsynaptic signal transmission
Reactome
Transmission across Chemical Synapses
Name
Explore in Pharos
Explore in Source
Neuronal System
Neurotransmitter receptors and postsynaptic signal transmission
Transmission across Chemical Synapses
Protein-Protein Interactions (27)
1 – 10 of 27
LRFN4
Tbio
Novelty: 0.15441176
p_int: 0.994287853
p_ni: 0.005696202
p_wrong: 0.000015945
Score: 0.189
Data Source: BioPlex,STRINGDB
RSPRY1
Tdark
Novelty: 0.46153846
p_int: 0.900152427
p_ni: 0.099847562
p_wrong: 1.1e-8
Score: 0.159
Data Source: BioPlex,STRINGDB
HSDL1
Tdark
Family: Enzyme
Novelty: 0.48275862
p_int: 0.889729469
p_ni: 0.11027053
p_wrong: 2e-9
Score: 0.239
Data Source: BioPlex,STRINGDB
HTR3A
Tclin
Family: IC
Novelty: 0.00035394
Score: 0.944
Data Source: Reactome,STRINGDB
RIC3
Tbio
Novelty: 0.02945063
Score: 0.558
Data Source: STRINGDB
HTR5A
Tchem
Family: GPCR
Novelty: 0.01826019
Score: 0.548
Data Source: STRINGDB
HTR7
Tclin
Family: GPCR
Novelty: 0.00190476
Score: 0.537
Data Source: STRINGDB
ZACN
Tchem
Family: IC
Novelty: 0.53571429
Score: 0.533
Data Source: STRINGDB
SNCA
Tchem
Novelty: 0.00021357
Score: 0.501
Data Source: STRINGDB
HTR1D
Tclin
Family: GPCR
Novelty: 0.00266446
Score: 0.476
Data Source: STRINGDB
Publication Statistics
PubMed Score  3.71

PubMed score by year
PubTator Score  4.11

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MQKHSPGPPALALLSQSLLTTGNGDTLIINCPGFGQHRVDPAAFQAVFDRKAIGPVTNYSVATHVNISFT
1-70
LSAIWNCYSRIHTFNCHHARPWHNQFVQWNPDECGGIKKSGMATENLWLSDVFIEESVDQTPAGLMASMS
70-140
IVKATSNTISQCGWSASANWTPSISPSMDRARAWRRMSRSFQIHHRTSFRTRREWVLLGIQKRTIKVTVA
140-210
TNQYEQAIFHVAIRRRCRPSPYVVNFLVPSGILIAIDALSFYLPLESGNCAPFKMTVLLGYSVFLLMMND
210-280
LLPATSTSSHASLVAPLALMQTPLPAGVYFALCLSLMVGSLLETIFITHLLHVATTQPLPLPRWLHSLLL
280-350
HCTGQGRCCPTAPQKGNKGPGLTPTHLPGVKEPEVSAGQMPGPGEAELTGGSEWTRAQREHEAQKQHSVE
350-420
LWVQFSHAMDALLFRLYLLFMASSIITVICLWNT
420-454
MQKHSPGPPALALLSQSLLTTGNGDTLIINCPGFGQHRVDPAAFQAVFDRKAIGPVTNYSVATHVNISFTLSAIWNCYSRIHTFNCHHARPWHNQFVQWNPDECGGIKKSGMATENLWLSDVFIEESVDQTPAGLMASMSIVKATSNTISQCGWSASANWTPSISPSMDRARAWRRMSRSFQIHHRTSFRTRREWVLLGIQKRTIKVTVATNQYEQAIFHVAIRRRCRPSPYVVNFLVPSGILIAIDALSFYLPLESGNCAPFKMTVLLGYSVFLLMMNDLLPATSTSSHASLVAPLALMQTPLPAGVYFALCLSLMVGSLLETIFITHLLHVATTQPLPLPRWLHSLLLHCTGQGRCCPTAPQKGNKGPGLTPTHLPGVKEPEVSAGQMPGPGEAELTGGSEWTRAQREHEAQKQHSVELWVQFSHAMDALLFRLYLLFMASSIITVICLWNT