You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ZNF365
Talanin

Protein Summary
Description
May play a role in uric acid excretion. This gene encodes several isoforms which have different expression patterns and functions. Mutation in this gene is associated with uric acid nephrolithiasis (UAN). Alternatively spliced variants, encoding distinct proteins, have been identified. [provided by RefSeq, May 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000395251
  • ENSP00000378672
  • ENSG00000138311
  • ENST00000614806
  • ENSP00000481372

Symbol
  • KIAA0844
  • UAN
  • Su48
  • ZNF365D
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 85.04   (req: < 5)
Gene RIFs: 15   (req: <= 3)
Antibodies: 367   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 85.04   (req: >= 5)
Gene RIFs: 15   (req: > 3)
Antibodies: 367   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (4)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Protein-Protein Interactions (48)
1 – 10 of 48
DISC1
Tbio
Novelty: 0.00165188
Score: 0.75
Data Source: STRINGDB
TNFSF4
Tbio
Novelty: 0.00378283
Score: 0.662
Data Source: STRINGDB
LSP1
Tbio
Novelty: 0.01170291
Score: 0.63
Data Source: STRINGDB
CTSH
Tchem
Family: Enzyme
Novelty: 0.00380318
Score: 0.619
Data Source: STRINGDB
NOTCH1
Tchem
Novelty: 0.00014278
Score: 0.586
Data Source: STRINGDB
ZNF684
Tdark
Family: TF
Score: 0.576
Data Source: STRINGDB
TOX3
Tbio
Family: TF
Novelty: 0.02037559
Score: 0.575
Data Source: STRINGDB
SLC22A12
Tclin
Family: Transporter
Novelty: 0.00100934
Score: 0.574
Data Source: STRINGDB
OLFM4
Tbio
Novelty: 0.01534099
Score: 0.568
Data Source: STRINGDB
NDEL1
Tbio
Novelty: 0.01425912
Score: 0.561
Data Source: STRINGDB
Publication Statistics
PubMed Score  85.04

PubMed score by year
PubTator Score  19.58

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSALGQITITVSRCWNTERNQTDKNPCLHGAYLQLRETVKNKSTHLKKPLMKQAPPWKDHLTFQPLHPAE
1-70
RKTQVWRWQSGNSSDLETTSSASPWPTGSNRDVVLNTLAESCCGLSELITAPPYAGVSIQGFSQIWVLFP
70-140
FCGGTFHHNEKDVLGLQDFERESVSTSQSRNISLLTLGQLQNCVIGKLTIIDLLTEHLLGVRHGVICFPW
140-210
GLPSSS
210-216
MSALGQITITVSRCWNTERNQTDKNPCLHGAYLQLRETVKNKSTHLKKPLMKQAPPWKDHLTFQPLHPAERKTQVWRWQSGNSSDLETTSSASPWPTGSNRDVVLNTLAESCCGLSELITAPPYAGVSIQGFSQIWVLFPFCGGTFHHNEKDVLGLQDFERESVSTSQSRNISLLTLGQLQNCVIGKLTIIDLLTEHLLGVRHGVICFPWGLPSSS