You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MOB2
MOB kinase activator 2

Protein Summary
Description
Stimulates the autophosphorylation and kinase activity of STK38 and STK38L.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000329957
  • ENSP00000328694
  • ENSG00000182208

Symbol
  • HCCA2
  • HCCA2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.66
tissue sample
0.65
transcription factor
0.63
cellular component
0.58
transcription factor binding site profile
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 32.17   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 140   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 32.17   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 140   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (9)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (35)
1 – 10 of 35
STK38
Tbio
Family: Kinase
Novelty: 0.04129184
p_int: 1
Score: 0.912
Data Source: BioPlex,STRINGDB
STK38L
Tchem
Family: Kinase
Novelty: 0.054716
p_int: 0.999999995
p_ni: 4e-9
p_wrong: 2e-9
Score: 0.942
Data Source: BioPlex,STRINGDB
LAMTOR5
Tbio
Novelty: 0.00523099
p_int: 0.990602896
p_ni: 0.00000718
p_wrong: 0.009389924
Data Source: BioPlex
LATS1
Tbio
Family: Kinase
Novelty: 0.00433613
Score: 0.909
Data Source: STRINGDB
STK4
Tchem
Family: Kinase
Novelty: 0.02467485
Score: 0.89
Data Source: STRINGDB
STK3
Tchem
Family: Kinase
Novelty: 0.09293063
Score: 0.882
Data Source: STRINGDB
LATS2
Tchem
Family: Kinase
Novelty: 0.00277994
Score: 0.874
Data Source: STRINGDB
MOB4
Tbio
Novelty: 0.04140583
Score: 0.746
Data Source: STRINGDB
CDC14A
Tbio
Family: Enzyme
Novelty: 0.00470507
Score: 0.693
Data Source: STRINGDB
CAB39
Tbio
Novelty: 0.02054329
Score: 0.631
Data Source: STRINGDB
Publication Statistics
PubMed Score  32.17

PubMed score by year
PubTator Score  12.54

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDWLMGKSKAKPNGKKPAAEERKAYLEPEHTKARITDFQFKELVVLPREIDLNEWLASNTTTFFHHINLQ
1-70
YSTISEFCTGETCQTMAVCNTQYYWYDERGKKVKCTAPQYVDFVMSSVQKLVTDEDVFPTKYGREFPSSF
70-140
ESLVRKICRHLFHVLAHIYWAHFKETLALELHGHLNTLYVHFILFAREFNLLDPKETAIMDDLTEVLCSG
140-210
AGGVHSGGSGDGAGSGGPGAQNHVKER
210-237
MDWLMGKSKAKPNGKKPAAEERKAYLEPEHTKARITDFQFKELVVLPREIDLNEWLASNTTTFFHHINLQYSTISEFCTGETCQTMAVCNTQYYWYDERGKKVKCTAPQYVDFVMSSVQKLVTDEDVFPTKYGREFPSSFESLVRKICRHLFHVLAHIYWAHFKETLALELHGHLNTLYVHFILFAREFNLLDPKETAIMDDLTEVLCSGAGGVHSGGSGDGAGSGGPGAQNHVKER