You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
KCTD8
BTB/POZ domain-containing protein KCTD8

Protein Classes
Protein Summary
Description
Auxiliary subunit of GABA-B receptors that determine the pharmacology and kinetics of the receptor response. Increases agonist potency and markedly alter the G-protein signaling of the receptors by accelerating onset and promoting desensitization (By similarity).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000360029
  • ENSP00000353129
  • ENSG00000183783
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.63
histone modification site profile
0.62
transcription factor binding site profile
0.59
cell line
0.47
cell type or tissue
0.46


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.49   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 82   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.49   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 82   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (6)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (33)
1 – 10 of 33
CEP162
Tdark
Novelty: 0.07272727
p_int: 0.910249981
p_ni: 0.089724153
p_wrong: 0.000025866
Score: 0.68
Data Source: BioPlex,STRINGDB
KCTD11
Tbio
Novelty: 0.11270079
Score: 0.669
Data Source: STRINGDB
KCTD19
Tdark
Novelty: 3.38461538
Score: 0.64
Data Source: STRINGDB
GABRG2
Tclin
Family: IC
Novelty: 0.01062612
Score: 0.618
Data Source: STRINGDB
KCTD20
Tdark
Novelty: 0.8603352
Score: 0.561
Data Source: STRINGDB
DLGAP1
Tbio
Novelty: 0.02426833
Score: 0.554
Data Source: STRINGDB
GABRB1
Tclin
Family: IC
Novelty: 0.04413659
Score: 0.541
Data Source: STRINGDB
KCNIP1
Tbio
Family: IC
Novelty: 0.02615849
Score: 0.533
Data Source: STRINGDB
SNCB
Tbio
Novelty: 0.00803532
Score: 0.531
Data Source: STRINGDB
COX7B2
Tdark
Family: Enzyme
Novelty: 1.55555556
Score: 0.53
Data Source: STRINGDB
Publication Statistics
PubMed Score  3.49

PubMed score by year
PubTator Score  3.33

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MALKDTGSGGSTILPISEMVSSSSSPGASAAAAPGPCAPSPFPEVVELNVGGQVYVTKHSTLLSVPDSTL
1-70
ASMFSPSSPRGGARRRGELPRDSRARFFIDRDGFLFRYVLDYLRDKQLALPEHFPEKERLLREAEYFQLT
70-140
DLVKLLSPKVTKQNSLNDEGCQSDLEDNVSQGSSDALLLRGAAAAVPSGPGAHGGGGGGGAQDKRSGFLT
140-210
LGYRGSYTTVRDNQADAKFRRVARIMVCGRIALAKEVFGDTLNESRDPDRQPEKYTSRFYLKFTYLEQAF
210-280
DRLSEAGFHMVACNSSGTAAFVNQYRDDKIWSSYTEYIFFRPPQKIVSPKQEHEDRKHDKVTDKGSESGT
280-350
SCNELSTSSCDSHSEASTPQDNPSSAQQATAHQPNTLTLDRPSKKAPVQWIPPPDKRRNSELFQTLISKS
350-420
RETNLSKKKVCEKLSVEEEMKKCIQDFKKIHIPDYFPERKRQWQSELLQKYGL
420-473
MALKDTGSGGSTILPISEMVSSSSSPGASAAAAPGPCAPSPFPEVVELNVGGQVYVTKHSTLLSVPDSTLASMFSPSSPRGGARRRGELPRDSRARFFIDRDGFLFRYVLDYLRDKQLALPEHFPEKERLLREAEYFQLTDLVKLLSPKVTKQNSLNDEGCQSDLEDNVSQGSSDALLLRGAAAAVPSGPGAHGGGGGGGAQDKRSGFLTLGYRGSYTTVRDNQADAKFRRVARIMVCGRIALAKEVFGDTLNESRDPDRQPEKYTSRFYLKFTYLEQAFDRLSEAGFHMVACNSSGTAAFVNQYRDDKIWSSYTEYIFFRPPQKIVSPKQEHEDRKHDKVTDKGSESGTSCNELSTSSCDSHSEASTPQDNPSSAQQATAHQPNTLTLDRPSKKAPVQWIPPPDKRRNSELFQTLISKSRETNLSKKKVCEKLSVEEEMKKCIQDFKKIHIPDYFPERKRQWQSELLQKYGL