You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
C3orf62
Uncharacterized protein C3orf62

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000343010
  • ENSP00000341139
  • ENSG00000188315
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.17   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 44   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.17   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 44   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (9)
1 – 9 of 9
EP300
Tchem
Family: Epigenetic
Novelty: 0.00060382
p_int: 0.999999774
p_ni: 2.26e-7
Score: 0.534
Data Source: BioPlex,STRINGDB
CREBBP
Tchem
Family: Epigenetic
Novelty: 0.00127032
p_int: 0.999997224
p_ni: 0.000002759
p_wrong: 1.7e-8
Score: 0.332
Data Source: BioPlex,STRINGDB
RBL1
Tbio
Novelty: 0.00255302
p_int: 0.999967342
p_ni: 0.000032658
Score: 0.295
Data Source: BioPlex,STRINGDB
RB1
Tchem
Novelty: 0.00084849
p_int: 0.981678345
p_ni: 0.018321655
Score: 0.209
Data Source: BioPlex,STRINGDB
SEZ6L
Tbio
Novelty: 0.1212956
Score: 0.626
Data Source: STRINGDB
CCDC36
Tdark
Novelty: 0.6185567
Score: 0.624
Data Source: STRINGDB
MYO18B
Tbio
Novelty: 0.05301173
Score: 0.529
Data Source: STRINGDB
GLIPR1L2
Tdark
Novelty: 1.98425197
Score: 0.515
Data Source: STRINGDB
USP4
Tbio
Family: Enzyme
Novelty: 0.00872265
Score: 0.441
Data Source: STRINGDB
Publication Statistics
PubMed Score  0.17

PubMed score by year
PubTator Score  0.25

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MHYIKTWSLLGEMSEKLRRCRKELTAAIDRAFEGVSYSQECTGQQRLELSAAPLSFSLPVHRLLCRRHPL
1-70
AACSSAAPFAAVPCAPENENPAFATNHAPVNAKPHALCPERKPLTSKENVLMHSSILAPERESWRTAGEG
70-140
ENWRKENLRKDMERDLKADSNMPLNNSSQEVTKDLLDMIDHTSIRTIEELAGKIEFENELNHMCGHCQDS
140-210
PFKEEAWALLMDKSPQKATDADPGSLKQAFDDHNIVETVLDLEEDYNVMTSFKYQIE
210-267
MHYIKTWSLLGEMSEKLRRCRKELTAAIDRAFEGVSYSQECTGQQRLELSAAPLSFSLPVHRLLCRRHPLAACSSAAPFAAVPCAPENENPAFATNHAPVNAKPHALCPERKPLTSKENVLMHSSILAPERESWRTAGEGENWRKENLRKDMERDLKADSNMPLNNSSQEVTKDLLDMIDHTSIRTIEELAGKIEFENELNHMCGHCQDSPFKEEAWALLMDKSPQKATDADPGSLKQAFDDHNIVETVLDLEEDYNVMTSFKYQIE