You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
ATP11AUN
Putative protein ATP11AUN

Protein Summary
Uniprot Accession IDs
Gene Name
Symbol
  • C13orf35
  • SMABLO1
  • C13orf35
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
trait
0.61
microRNA
0.54
tissue
0.53
cell line
0.45
chemical
0.41


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 0   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 0   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (5)
1 – 5 of 5
ANAPC16
Tdark
Family: Enzyme
Novelty: 0.09302326
Score: 0.53
Data Source: STRINGDB
SPOUT1
Tbio
Family: Enzyme
Novelty: 0.07107802
Score: 0.489
Data Source: STRINGDB
SKA3
Tbio
Novelty: 0.08112545
Score: 0.445
Data Source: STRINGDB
MCF2L
Tbio
Novelty: 0.10026867
Score: 0.424
Data Source: STRINGDB
ZNF276
Tdark
Family: TF
Novelty: 0.5
Score: 0.408
Data Source: STRINGDB
Publication Statistics
Amino Acid Sequence
Residue Counts
Sequence
MNSPEARLCVAQCRDSYPGCQPLKDTRAWASSLKMDPAGLEGGPRDESRDEPPIRAQAASWDQPQGCLTY
1-70
KGRRSASGTQKQLQLPDTLSSLLCWRGAIMVYIKVTVQTDDSNKLLSLLYR
70-121
MNSPEARLCVAQCRDSYPGCQPLKDTRAWASSLKMDPAGLEGGPRDESRDEPPIRAQAASWDQPQGCLTYKGRRSASGTQKQLQLPDTLSSLLCWRGAIMVYIKVTVQTDDSNKLLSLLYR