You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
MBOAT1
Lysophospholipid acyltransferase 1

Protein Summary
Description
Acyltransferase which mediates the conversion of lysophosphatidylserine (1-acyl-2-hydroxy-sn-glycero-3-phospho-L-serine or LPS) into phosphatidylserine (1,2-diacyl-sn-glycero-3-phospho-L-serine or PS) (LPSAT activity). Prefers oleoyl-CoA as the acyl donor. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle. This gene belongs to the membrane-bound O-acetyltransferase superfamily. The encoded transmembrane protein is an enzyme that transfers organic compounds, preferably from oleoyl-CoA, to hydroxyl groups of protein targets in membranes. A translocation disrupting this gene may be associated with brachydactyly syndactyly syndrome. Alternately spliced transcript variants have been described for this gene. [provided by RefSeq, Nov 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000324607
  • ENSP00000324944
  • ENSG00000172197

Symbol
  • OACT1
  • LPLAT
  • LPSAT
  • OACT1
  • LPEAT1
  • LPLAT 1
  • dJ434O11.1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.88
histone modification site profile
0.81
phenotype
0.68
cellular component
0.66
trait
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9.98   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 30   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9.98   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 30   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (43)
Acyl chain remodelling of PE (R-HSA-1482839)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Acyl chain remodelling of PE
Reactome
Acyl chain remodelling of PS
Reactome
Glycerophospholipid biosynthesis
Reactome
Metabolism
Reactome
Metabolism of lipids
Name
Explore in Pharos
Explore in Source
Acyl chain remodelling of PE
Acyl chain remodelling of PS
Glycerophospholipid biosynthesis
Metabolism
Metabolism of lipids
Protein-Protein Interactions (92)
1 – 10 of 92
PISD
Tbio
Family: Enzyme
Novelty: 0.00936733
Score: 0.964
Data Source: STRINGDB
CEPT1
Tbio
Family: Enzyme
Novelty: 0.02109745
Score: 0.963
Data Source: STRINGDB
LCLAT1
Tbio
Family: Enzyme
Novelty: 0.0461716
Score: 0.949
Data Source: STRINGDB
GPAT4
Tbio
Family: Enzyme
Novelty: 0.04994969
Score: 0.948
Data Source: STRINGDB
PEMT
Tbio
Family: Enzyme
Novelty: 0.01013987
Score: 0.946
Data Source: STRINGDB
AGPAT1
Tbio
Family: Enzyme
Novelty: 0.08786232
Score: 0.944
Data Source: STRINGDB
AGPAT2
Tchem
Family: Enzyme
Novelty: 0.01071372
Score: 0.943
Data Source: STRINGDB
LPCAT4
Tdark
Family: Enzyme
Novelty: 0.22556391
Score: 0.939
Data Source: STRINGDB
GPAT3
Tbio
Family: Enzyme
Novelty: 0.05392755
Score: 0.939
Data Source: STRINGDB
GPAM
Tbio
Family: Enzyme
Novelty: 0.00895841
Score: 0.937
Data Source: STRINGDB
Publication Statistics
PubMed Score  9.98

PubMed score by year
PubTator Score  4.16

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFRIYLRPGTTSSDVRHAVATI
1-70
FGIYFVIFCFGWYSVHLFVLVLMCYAIMVTASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDFSG
70-140
PLMIVTQKITTLAFQVHDGLGRRAEDLSAEQHRLAIKVKPSFLEYLSYLLNFMSVIAGPCNNFKDYIAFI
140-210
EGKHIHMKLLEVNWKRKGFHSLPEPSPTGAVIHKLGITLVSLLLFLTLTKTFPVTCLVDDWFVHKASFPA
210-280
RLCYLYVVMQASKPKYYFAWTLADAVNNAAGFGFSGVDKNGNFCWDLLSNLNIWKIETATSFKMYLENWN
280-350
IQTATWLKCVCYQRVPWYPTVLTFILSALWHGVYPGYYFTFLTGILVTLAARAVRNNYRHYFLSSRALKA
350-420
VYDAGTWAVTQLAVSYTVAPFVMLAVEPTISLYKSMYFYLHIISLLIILFLPMKPQAHTQRRPQTLNSIN
420-490
KRKTD
490-495
MAAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFRIYLRPGTTSSDVRHAVATIFGIYFVIFCFGWYSVHLFVLVLMCYAIMVTASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDGLGRRAEDLSAEQHRLAIKVKPSFLEYLSYLLNFMSVIAGPCNNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSPTGAVIHKLGITLVSLLLFLTLTKTFPVTCLVDDWFVHKASFPARLCYLYVVMQASKPKYYFAWTLADAVNNAAGFGFSGVDKNGNFCWDLLSNLNIWKIETATSFKMYLENWNIQTATWLKCVCYQRVPWYPTVLTFILSALWHGVYPGYYFTFLTGILVTLAARAVRNNYRHYFLSSRALKAVYDAGTWAVTQLAVSYTVAPFVMLAVEPTISLYKSMYFYLHIISLLIILFLPMKPQAHTQRRPQTLNSINKRKTD