You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
CCDC81
Coiled-coil domain-containing protein 81

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000354755
  • ENSP00000346800
  • ENSG00000149201
  • ENST00000445632
  • ENSP00000415528
  • ENST00000528728
  • ENSP00000437165
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.82
cell type or tissue
0.62
tissue
0.58
cellular component
0.57
phenotype
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.11   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 97   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.11   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 97   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (2)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (47)
1 – 10 of 47
MRM1
Tbio
Family: Enzyme
Novelty: 0.27243243
Score: 0.731
Data Source: STRINGDB
C4orf47
Tdark
Novelty: 8
Score: 0.709
Data Source: STRINGDB
TINAG
Tbio
Novelty: 0.04045398
Score: 0.707
Data Source: STRINGDB
C7orf31
Tdark
Novelty: 1.84615385
Score: 0.669
Data Source: STRINGDB
CCDC96
Tdark
Novelty: 8
Score: 0.669
Data Source: STRINGDB
CCDC146
Tdark
Novelty: 1.42465753
Score: 0.583
Data Source: STRINGDB
FAM217A
Tdark
Score: 0.581
Data Source: STRINGDB
NDUFAF8
Tbio
Novelty: 2
Score: 0.559
Data Source: STRINGDB
OR6M1
Tdark
Family: oGPCR
Novelty: 5
Score: 0.559
Data Source: STRINGDB
OR8H3
Tdark
Family: oGPCR
Score: 0.557
Data Source: STRINGDB
Publication Statistics
PubMed Score  0.11

PubMed score by year
PubTator Score  1.1

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLDTIARALQDLGRQVLPTLPSLSQEEVSIIWGNVSEFVRRQLTLHKGVQIPAFGTFTFIRQKLEVGNNK
1-70
FILIQRPVFIMVEKLVQIHGLKQNKVYTPGEIPIVPLNFVMISLEGPFNRDVVEGCVKETLLFLSRSISM
70-140
KQNVEFTFKGIGVLMIRDSKVKMRFYKDFLCTMDGSGALAKALANRPGTVDSVLSSREALRKWPSSVLAF
140-210
PRIELKEMENKLPMETLVEECGENRERKCKLKDQSDKEEGTRDISSPKRLRDRQALFPAKVTNVSLLEKF
210-280
ERSESGGKIMTPESLSYPSCLKHDSEMKPQTSPACQDHNKAGQEMCYVCLQRAQRNSLLYYSEERRREIE
280-350
DERLIQQYQMLKDQEALFRHQMKSLATREQNQKNAAYNLGVAEAIRNHKNEKPEFYKSFLFDKRPLSPAL
350-420
NALKQEEYSRSLLKQMDNRQENEIKQRQYRELMDRLEQVQLTEELAAQRAKFLKDKMEETQCYKRALDAQ
420-490
IKNKPSRLPPFEPDSSEPIFGKNEGELMVEKQKREQNYMKHQLEAAANHKRKAILHQLVDQRRDLQMLQR
490-560
TQREHLADRTAELERVNRVNQCLQEDWERSAAMKKQRDLEDKAFERASDKLFLLDQCEKYRRCKQCQRRT
560-630
SNVGESNLWPLNKFLPGSRLLV
630-652
MLDTIARALQDLGRQVLPTLPSLSQEEVSIIWGNVSEFVRRQLTLHKGVQIPAFGTFTFIRQKLEVGNNKFILIQRPVFIMVEKLVQIHGLKQNKVYTPGEIPIVPLNFVMISLEGPFNRDVVEGCVKETLLFLSRSISMKQNVEFTFKGIGVLMIRDSKVKMRFYKDFLCTMDGSGALAKALANRPGTVDSVLSSREALRKWPSSVLAFPRIELKEMENKLPMETLVEECGENRERKCKLKDQSDKEEGTRDISSPKRLRDRQALFPAKVTNVSLLEKFERSESGGKIMTPESLSYPSCLKHDSEMKPQTSPACQDHNKAGQEMCYVCLQRAQRNSLLYYSEERRREIEDERLIQQYQMLKDQEALFRHQMKSLATREQNQKNAAYNLGVAEAIRNHKNEKPEFYKSFLFDKRPLSPALNALKQEEYSRSLLKQMDNRQENEIKQRQYRELMDRLEQVQLTEELAAQRAKFLKDKMEETQCYKRALDAQIKNKPSRLPPFEPDSSEPIFGKNEGELMVEKQKREQNYMKHQLEAAANHKRKAILHQLVDQRRDLQMLQRTQREHLADRTAELERVNRVNQCLQEDWERSAAMKKQRDLEDKAFERASDKLFLLDQCEKYRRCKQCQRRTSNVGESNLWPLNKFLPGSRLLV