You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CYP26C1
Cytochrome P450 26C1

Protein Summary
Description
Plays a role in retinoic acid metabolism. Acts on retinoids, including all-trans-retinoic acid (RA) and its stereoisomer 9-cis-RA (preferred substrate). This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme is involved in the catabolism of all-trans- and 9-cis-retinoic acid, and thus contributes to the regulation of retinoic acid levels in cells and tissues. This gene is adjacent to a related gene on chromosome 10q23.33. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000285949
  • ENSP00000285949
  • ENSG00000187553

Symbol
  • FFDD4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.84
pathway
0.7
biological process
0.6
tissue sample
0.55
metabolite
0.45


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11.17   (req: < 5)
Gene RIFs: 9   (req: <= 3)
Antibodies: 130   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11.17   (req: >= 5)
Gene RIFs: 9   (req: > 3)
Antibodies: 130   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (24)
Biological oxidations (R-HSA-211859)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 13
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Biological oxidations
Reactome
Cytochrome P450 - arranged by substrate type
Reactome
Defective CYP26C1 causes Focal facial dermal dysplasia 4 (FFDD4)
Reactome
Disease
Reactome
Diseases of metabolism
Name
Explore in Pharos
Explore in Source
Biological oxidations
Cytochrome P450 - arranged by substrate type
Defective CYP26C1 causes Focal facial dermal dysplasia 4 (FFDD4)
Disease
Diseases of metabolism
Protein-Protein Interactions (70)
1 – 10 of 70
ALDH1A2
Tbio
Family: Enzyme
Novelty: 0.00544461
Score: 0.964
Data Source: STRINGDB
ALDH1A1
Tchem
Family: Enzyme
Novelty: 0.00144812
Score: 0.953
Data Source: STRINGDB
CRABP1
Tbio
Novelty: 0.00320013
Score: 0.941
Data Source: Reactome,STRINGDB
CYP2S1
Tbio
Novelty: 0.04038753
Score: 0.927
Data Source: STRINGDB
CYP4A11
Tbio
Novelty: 0.01325821
Score: 0.927
Data Source: STRINGDB
CYP1A1
Tchem
Novelty: 0.00028982
Score: 0.926
Data Source: STRINGDB
CYP2B6
Tchem
Novelty: 0.00018723
Score: 0.925
Data Source: STRINGDB
CYP3A4
Tclin
Family: Enzyme
Novelty: 0.00020884
Score: 0.923
Data Source: STRINGDB
CYP3A7
Tclin
Family: Enzyme
Novelty: 0.00963214
Score: 0.923
Data Source: STRINGDB
CYP3A5
Tclin
Family: Enzyme
Novelty: 0.00135473
Score: 0.921
Data Source: STRINGDB
Publication Statistics
PubMed Score  11.17

PubMed score by year
PubTator Score  11.08

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MFPWGLSCLSVLGAAGTALLCAGLLLSLAQHLWTLRWMLSRDRASTLPLPKGSMGWPFFGETLHWLVQGS
1-70
RFHSSRRERYGTVFKTHLLGRPVIRVSGAENVRTILLGEHRLVRSQWPQSAHILLGSHTLLGAVGEPHRR
70-140
RRKVLARVFSRAALERYVPRLQGALRHEVRSWCAAGGPVSVYDASKALTFRMAARILLGLRLDEAQCATL
140-210
ARTFEQLVENLFSLPLDVPFSGLRKGIRARDQLHRHLEGAISEKLHEDKAAEPGDALDLIIHSARELGHE
210-280
PSMQELKESAVELLFAAFFTTASASTSLVLLLLQHPAAIAKIREELVAQGLGRACGCAPGAAGGSEGPPP
280-350
DCGCEPDLSLAALGRLRYVDCVVKEVLRLLPPVSGGYRTALRTFELDGYQIPKGWSVMYSIRDTHETAAV
350-420
YRSPPEGFDPERFGAAREDSRGASSRFHYIPFGGGARSCLGQELAQAVLQLLAVELVRTARWELATPAFP
420-490
AMQTVPIVHPVDGLRLFFHPLTPSVAGNGLCL
490-522
MFPWGLSCLSVLGAAGTALLCAGLLLSLAQHLWTLRWMLSRDRASTLPLPKGSMGWPFFGETLHWLVQGSRFHSSRRERYGTVFKTHLLGRPVIRVSGAENVRTILLGEHRLVRSQWPQSAHILLGSHTLLGAVGEPHRRRRKVLARVFSRAALERYVPRLQGALRHEVRSWCAAGGPVSVYDASKALTFRMAARILLGLRLDEAQCATLARTFEQLVENLFSLPLDVPFSGLRKGIRARDQLHRHLEGAISEKLHEDKAAEPGDALDLIIHSARELGHEPSMQELKESAVELLFAAFFTTASASTSLVLLLLQHPAAIAKIREELVAQGLGRACGCAPGAAGGSEGPPPDCGCEPDLSLAALGRLRYVDCVVKEVLRLLPPVSGGYRTALRTFELDGYQIPKGWSVMYSIRDTHETAAVYRSPPEGFDPERFGAAREDSRGASSRFHYIPFGGGARSCLGQELAQAVLQLLAVELVRTARWELATPAFPAMQTVPIVHPVDGLRLFFHPLTPSVAGNGLCL