You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CXCL17
C-X-C motif chemokine 17

Protein Summary
Description
Chemokine that acts as chemoattractant for monocytes, macrophages and dendritic cells (PubMed:16455961, PubMed:23115081). Plays a role in angiogenesis and possibly in the development of tumors (PubMed:16989774, PubMed:23115081). Acts as an anti-inflammatory in the stomach (PubMed:23115081). May play a role in the innate defense against infections (PubMed:17307946). Activates the C-X-C chemokine receptor GPR35 to induce a rapid and transient rise in the level of intracellular calcium ions (PubMed:25411203). 4-Cys CXCL17: seems exhibit much higher chemoattractant potency on monocytes and macrophages than 6-Cys CXCL17. The protein encoded by this gene is a mucosal chemokine that attracts immature dendritic cells and blood monocytes to the lungs. The encoded protein also promotes tumorigenesis through an angiogenic activity. Finally, this protein exhibits strong antimicrobial activity against E. coli, S. aureus, Salmonella, P. aeruginosa, and C. albicans. Two transcript variants, one prote ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000601181
  • ENSP00000472467
  • ENSG00000189377

Symbol
  • VCC1
  • DMC
  • VCC1
  • Dcip1
  • VCC-1
  • UNQ473
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.95
cell line
0.49
tissue
0.45
PubMedID
0.39
biological term
0.38


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 29.09   (req: < 5)
Gene RIFs: 13   (req: <= 3)
Antibodies: 89   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 29.09   (req: >= 5)
Gene RIFs: 13   (req: > 3)
Antibodies: 89   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (9)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Mutant Phenotype (IMP)
UniProtKB
Protein-Protein Interactions (27)
1 – 10 of 27
XCL2
Tbio
Novelty: 0.072835
Score: 0.792
Data Source: STRINGDB
CCL25
Tbio
Novelty: 0.01203102
Score: 0.784
Data Source: STRINGDB
GPR35
Tchem
Family: GPCR
Novelty: 0.01454991
Score: 0.734
Data Source: STRINGDB
CCL20
Tbio
Novelty: 0.00082571
Score: 0.701
Data Source: STRINGDB
CCL2
Tchem
Novelty: 0.00013411
Score: 0.684
Data Source: STRINGDB
CCL8
Tbio
Novelty: 0.0062709
Score: 0.68
Data Source: STRINGDB
CCL17
Tbio
Novelty: 0.00211433
Score: 0.651
Data Source: STRINGDB
CCL16
Tbio
Novelty: 0.00156073
Score: 0.646
Data Source: STRINGDB
CXCL14
Tbio
Novelty: 0.00409029
Score: 0.632
Data Source: STRINGDB
CCL5
Tchem
Novelty: 0.00039604
Score: 0.524
Data Source: STRINGDB
Publication Statistics
PubMed Score  29.09

PubMed score by year
PubTator Score  21.51

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKVLISSLLLLLPLMLMSMVSSSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGL
1-70
PKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL
70-119
MKVLISSLLLLLPLMLMSMVSSSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL