You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CRTC1
CREB-regulated transcription coactivator 1

Protein Summary
Description
Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 with TAF4. Regulates the expression of specific CREB-activated genes such as the steroidogenic gene, StAR. Potent coactivator of PGC1alpha and inducer of mitochondrial biogenesis in muscle cells. In the hippocampus, involved in late-phase long-term potentiation (L-LTP) maintenance at the Schaffer collateral-CA1 synapses. May be required for dendritic growth of developing cortical neurons (By similarity). In concert with SIK1, regulates the light-induced entrainment of the circadian clock. In response to light stimulus, coactivates the CREB-mediated transcription of PER1 which plays an important role in the photic entrainment of the circadian clock. (Microbial infectio ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000321949
  • ENSP00000323332
  • ENSG00000105662
  • ENST00000338797
  • ENSP00000345001

Symbol
  • KIAA0616
  • MECT1
  • TORC1
  • WAMTP1
  • MAML2
  • MECT1
  • Mam-2
  • TORC1
  • TORC-1
  • WAMTP1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.83
biological process
0.76
cell type or tissue
0.72
transcription factor binding site profile
0.66
tissue
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 70.02   (req: < 5)
Gene RIFs: 61   (req: <= 3)
Antibodies: 326   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 70.02   (req: >= 5)
Gene RIFs: 61   (req: > 3)
Antibodies: 326   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (12)
Circadian Clock (R-HSA-400253)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Circadian Clock
Reactome
Mitochondrial biogenesis
Reactome
Organelle biogenesis and maintenance
Reactome
Transcriptional activation of mitochondrial biogenesis
Name
Explore in Pharos
Explore in Source
Circadian Clock
Mitochondrial biogenesis
Organelle biogenesis and maintenance
Transcriptional activation of mitochondrial biogenesis
Protein-Protein Interactions (60)
1 – 10 of 60
CREB1
Tbio
Family: TF
Novelty: 0.00022127
Score: 0.994
Data Source: Reactome,STRINGDB
PPARGC1A
Tbio
Novelty: 0.00121082
Score: 0.926
Data Source: STRINGDB
FOS
Tbio
Family: TF
Novelty: 0.00007002
Score: 0.925
Data Source: STRINGDB
JUN
Tchem
Family: TF
Novelty: 0.00013623
Score: 0.916
Data Source: STRINGDB
PER1
Tbio
Novelty: 0.01389509
Score: 0.912
Data Source: STRINGDB
MAML2
Tbio
Novelty: 0.01290922
Score: 0.895
Data Source: STRINGDB
CRTC3
Tbio
Novelty: 0.05648333
Score: 0.84
Data Source: STRINGDB
CRTC2
Tbio
Novelty: 0.02665733
Score: 0.831
Data Source: STRINGDB
CREM
Tbio
Family: TF
Novelty: 0.00090177
Score: 0.827
Data Source: STRINGDB
HCN2
Tclin
Family: IC
Novelty: 0.0314591
Score: 0.822
Data Source: STRINGDB
Publication Statistics
PubMed Score  70.02

PubMed score by year
PubTator Score  204.75

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MATSNNPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQYYGGSLPNVNQ
1-70
IGSGTMDLPFQTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLSVDKHGRQADSCPYGTMYLSP
70-140
PADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTG
140-210
SRPKSCEVPGINIFPSADQENTTALIPATHNTGGSLPDLTNIHFPSPLPTPLDPEEPTFPALSSSSSTGN
210-280
LAANLTHLGIGGAGQGMSTPGSSPQHRPAGVSPLSLSTEARRQQASPTLSPLSPITQAVAMDALSLEQQL
280-350
PYAFFTQAGSQQPPPQPQPPPPPPPASQQPPPPPPPQAPVRLPPGGPLLPSASLTRGPQPPPLAVTVPSS
350-420
LPQSPPENPGQPSMGIDIASAPALQQYRTSAGSPANQSPTSPVSNQGFSPGSSPQHTSTLGSVFGDAYYE
420-490
QQMAARQANALSHQLEQFNMMENAISSSSLYSPGSTLNYSQAAMMGLTGSHGSLPDSQQLGYASHSGIPN
490-560
IILTVTGESPPSLSKELTSSLAGVGDVSFDSDSQFPLDELKIDPLTLDGLHMLNDPDMVLADPATEDTFR
560-630
MDRL
630-634
MATSNNPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQYYGGSLPNVNQIGSGTMDLPFQTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLSVDKHGRQADSCPYGTMYLSPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEVPGINIFPSADQENTTALIPATHNTGGSLPDLTNIHFPSPLPTPLDPEEPTFPALSSSSSTGNLAANLTHLGIGGAGQGMSTPGSSPQHRPAGVSPLSLSTEARRQQASPTLSPLSPITQAVAMDALSLEQQLPYAFFTQAGSQQPPPQPQPPPPPPPASQQPPPPPPPQAPVRLPPGGPLLPSASLTRGPQPPPLAVTVPSSLPQSPPENPGQPSMGIDIASAPALQQYRTSAGSPANQSPTSPVSNQGFSPGSSPQHTSTLGSVFGDAYYEQQMAARQANALSHQLEQFNMMENAISSSSLYSPGSTLNYSQAAMMGLTGSHGSLPDSQQLGYASHSGIPNIILTVTGESPPSLSKELTSSLAGVGDVSFDSDSQFPLDELKIDPLTLDGLHMLNDPDMVLADPATEDTFRMDRL