You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CRTC3
CREB-regulated transcription coactivator 3

Protein Summary
Description
Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 with TAF4. Regulates the expression of specific CREB-activated genes such as the steroidogenic gene, StAR. Potent coactivator of PPARGC1A and inducer of mitochondrial biogenesis in muscle cells. Also coactivator for TAX activation of the human T-cell leukemia virus type 1 (HTLV-1) long terminal repeats (LTR). This gene is a member of the CREB regulated transcription coactivator gene family. This family regulates CREB-dependent gene transcription in a phosphorylation-independent manner and may be selective for cAMP-responsive genes. The protein encoded by this gene may induce mitochondrial biogenesis and attenuate catecholamine signaling in adipose tissue. A translocat ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000268184
  • ENSP00000268184
  • ENSG00000140577
  • ENST00000420329
  • ENSP00000416573

Symbol
  • TORC3
  • TORC3
  • TORC-3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.81
transcription factor perturbation
0.8
cell type or tissue
0.7
transcription factor binding site profile
0.69
microRNA
0.67


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 17.18   (req: < 5)
Gene RIFs: 16   (req: <= 3)
Antibodies: 118   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 17.18   (req: >= 5)
Gene RIFs: 16   (req: > 3)
Antibodies: 118   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (5)
Circadian Clock (R-HSA-400253)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Circadian Clock
Reactome
Mitochondrial biogenesis
Reactome
Organelle biogenesis and maintenance
Reactome
Transcriptional activation of mitochondrial biogenesis
Name
Explore in Pharos
Explore in Source
Circadian Clock
Mitochondrial biogenesis
Organelle biogenesis and maintenance
Transcriptional activation of mitochondrial biogenesis
Gene Ontology Terms (13)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (53)
1 – 10 of 53
KIAA1549
Tbio
Novelty: 0.01648616
p_int: 0.999998843
p_ni: 0.000001157
Data Source: BioPlex
MAGEA10
Tbio
Novelty: 0.0518709
p_int: 0.99373435
p_ni: 1e-7
p_wrong: 0.00626555
Score: 0.209
Data Source: BioPlex,STRINGDB
CREB1
Tbio
Family: TF
Novelty: 0.00022127
Score: 0.973
Data Source: Reactome,STRINGDB
PPARGC1A
Tbio
Novelty: 0.00121082
Score: 0.948
Data Source: STRINGDB
CRTC1
Tbio
Novelty: 0.01467942
Score: 0.84
Data Source: STRINGDB
CRTC2
Tbio
Novelty: 0.02665733
Score: 0.833
Data Source: STRINGDB
CREM
Tbio
Family: TF
Novelty: 0.00090177
Score: 0.794
Data Source: STRINGDB
ATF1
Tchem
Family: TF
Novelty: 0.01654271
Score: 0.759
Data Source: STRINGDB
EML5
Tdark
Novelty: 0.32315978
Score: 0.713
Data Source: STRINGDB
SIK2
Tchem
Family: Kinase
Novelty: 0.02679057
Score: 0.694
Data Source: STRINGDB
Publication Statistics
PubMed Score  17.18

PubMed score by year
PubTator Score  18.91

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAASPGSGSANPRKFSEKIALHTQRQAEETRAFEQLMTDLTLSRVQFQKLQQLRLTQYHGGSLPNVSQLR
1-70
SSASEFQPSFHQADNVRGTRHHGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQ
70-140
PPWKDEKHPGFRLTSALNRTNSDSALHTSALSTKPQDPYGGGGQSAWPAPYMGFCDGENNGHGEVASFPG
140-210
PLKEENLLNVPKPLPKQLWETKEIQSLSGRPRSCDVGGGNAFPHNGQNLGLSPFLGTLNTGGSLPDLTNL
210-280
HYSTPLPASLDTTDHHFGSMSVGNSVNNIPAAMTHLGIRSSSGLQSSRSNPSIQATLNKTVLSSSLNNHP
280-350
QTSVPNASALHPSLRLFSLSNPSLSTTNLSGPSRRRQPPVSPLTLSPGPEAHQGFSRQLSSTSPLAPYPT
350-420
SQMVSSDRSQLSFLPTEAQAQVSPPPPYPAPQELTQPLLQQPRAPEAPAQQPQAASSLPQSDFQLLPAQG
420-490
SSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSNCGSLPNTILPEDSSTSLFKD
490-560
LNSALAGLPEVSLNVDTPFPLEEELQIEPLSLDGLNMLSDSSMGLLDPSVEETFRADRL
560-619
MAASPGSGSANPRKFSEKIALHTQRQAEETRAFEQLMTDLTLSRVQFQKLQQLRLTQYHGGSLPNVSQLRSSASEFQPSFHQADNVRGTRHHGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQPPWKDEKHPGFRLTSALNRTNSDSALHTSALSTKPQDPYGGGGQSAWPAPYMGFCDGENNGHGEVASFPGPLKEENLLNVPKPLPKQLWETKEIQSLSGRPRSCDVGGGNAFPHNGQNLGLSPFLGTLNTGGSLPDLTNLHYSTPLPASLDTTDHHFGSMSVGNSVNNIPAAMTHLGIRSSSGLQSSRSNPSIQATLNKTVLSSSLNNHPQTSVPNASALHPSLRLFSLSNPSLSTTNLSGPSRRRQPPVSPLTLSPGPEAHQGFSRQLSSTSPLAPYPTSQMVSSDRSQLSFLPTEAQAQVSPPPPYPAPQELTQPLLQQPRAPEAPAQQPQAASSLPQSDFQLLPAQGSSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSNCGSLPNTILPEDSSTSLFKDLNSALAGLPEVSLNVDTPFPLEEELQIEPLSLDGLNMLSDSSMGLLDPSVEETFRADRL