You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
CASC1
Protein CASC1

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000320267
  • ENSP00000313141
  • ENSG00000118307
  • ENST00000354189
  • ENSP00000346126
  • ENST00000395990
  • ENSP00000379313
  • ENST00000545133
  • ENSP00000437373

Symbol
  • LAS1
  • PPP1R54
  • LAS1
  • PPP1R54
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.9
cell line
0.72
transcription factor binding site profile
0.72
tissue sample
0.62
PubMedID
0.59


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 8.49   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 33   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 8.49   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 33   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (49)
1 – 10 of 49
RUNDC1
Tdark
Novelty: 1.55555556
p_int: 0.999620077
p_ni: 0.00037992
p_wrong: 3e-9
Score: 0.44
Data Source: BioPlex,STRINGDB
LRIF1
Tdark
Novelty: 0.27114267
p_int: 0.933619194
p_ni: 0.066317329
p_wrong: 0.000063477
Score: 0.187
Data Source: BioPlex,STRINGDB
MYO9A
Tbio
Novelty: 0.11849865
p_int: 0.799110328
p_ni: 0.200889672
Score: 0.204
Data Source: BioPlex,STRINGDB
FN3KRP
Tbio
Family: Kinase
Novelty: 0.13370228
Score: 0.743
Data Source: STRINGDB
LRMP
Tbio
Novelty: 0.06253661
Score: 0.719
Data Source: STRINGDB
RIOK2
Tbio
Family: Kinase
Novelty: 0.04643193
Score: 0.711
Data Source: STRINGDB
LMNTD1
Tdark
Novelty: 0.55045872
Score: 0.684
Data Source: STRINGDB
CCDC18
Tdark
Novelty: 1.66666667
Score: 0.669
Data Source: STRINGDB
ETFRF1
Tdark
Novelty: 2
Score: 0.655
Data Source: STRINGDB
CFAP36
Tdark
Novelty: 0.5060241
Score: 0.648
Data Source: STRINGDB
Publication Statistics
PubMed Score  8.49

PubMed score by year
PubTator Score  8.62

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSGSKKKKVTKAERLKLLQEEEERRLKEEEEARLKYEKEEMERLEIQRIEKEKWHRLEAKDLERRNEELE
1-70
ELYLLERCFPEAEKLKQETKLLSQWKHYIQCDGSPDPSVAQEMNTFISLWKEKTNETFEEVIEKSKVVLN
70-140
LIEKLKFILLETPPCDLQDKNIIQYQESILQLQELLHLKFGVATEILLKQASTLADLDSGNMEKVIKDEN
140-210
VTLYVWANLKKNPRHRSVRFSETQIGFEIPRILATSDIAVRLLHTHYDHVSALHPVSTPSKEYTSAVTEL
210-280
VKDDVKNVEKAISKEVEEESKQQERGSHLIQEEEIKVEEEQGDIEVKMSSAEEESEAIKCEREMKVLSET
280-350
VSAAQLLLVENSSEKPDFFEDNVVDLCQFTTLGGVYHLDILELPPQCKPVKGWMIVEILKEGLQKYTYPP
350-420
ETTEEFETENAFPPIEVTLEVHENVIFFEDPVVVRWDAEGKHWRTDGISNVSYKPKERLVTFSLDTFGPV
420-490
TLIQDAHINMPYQSWELRPLDVNKVLLTVTTVFTEIQIQIKENLCMLSSIKLKDKKHISILEGTWMTPIP
490-560
FIIALKEAGLNIFPTRHSHFYVIINNKVPLVEVKAYRQMALLSSAFAFGWSKWNLLCNSTKVVFKVREHL
560-630
TEACTENPNWALLMFSGDRAQRLKIKEESEAFSEALKEETEFHSTLYHMVKDFASEEAMEKVRSSNCQFV
630-700
NSVCHMLLSTRLLSYS
700-716
MSGSKKKKVTKAERLKLLQEEEERRLKEEEEARLKYEKEEMERLEIQRIEKEKWHRLEAKDLERRNEELEELYLLERCFPEAEKLKQETKLLSQWKHYIQCDGSPDPSVAQEMNTFISLWKEKTNETFEEVIEKSKVVLNLIEKLKFILLETPPCDLQDKNIIQYQESILQLQELLHLKFGVATEILLKQASTLADLDSGNMEKVIKDENVTLYVWANLKKNPRHRSVRFSETQIGFEIPRILATSDIAVRLLHTHYDHVSALHPVSTPSKEYTSAVTELVKDDVKNVEKAISKEVEEESKQQERGSHLIQEEEIKVEEEQGDIEVKMSSAEEESEAIKCEREMKVLSETVSAAQLLLVENSSEKPDFFEDNVVDLCQFTTLGGVYHLDILELPPQCKPVKGWMIVEILKEGLQKYTYPPETTEEFETENAFPPIEVTLEVHENVIFFEDPVVVRWDAEGKHWRTDGISNVSYKPKERLVTFSLDTFGPVTLIQDAHINMPYQSWELRPLDVNKVLLTVTTVFTEIQIQIKENLCMLSSIKLKDKKHISILEGTWMTPIPFIIALKEAGLNIFPTRHSHFYVIINNKVPLVEVKAYRQMALLSSAFAFGWSKWNLLCNSTKVVFKVREHLTEACTENPNWALLMFSGDRAQRLKIKEESEAFSEALKEETEFHSTLYHMVKDFASEEAMEKVRSSNCQFVNSVCHMLLSTRLLSYS