You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
RASL11A
Ras-like protein family member 11A

Protein Summary
Description
Regulator of rDNA transcription. Acts in cooperation UBF/UBTF and positively regulates RNA polymerase I transcription (By similarity). RASL11A is a member of the small GTPase protein family with a high degree of similarity to RAS (see HRAS, MIM 190020) proteins.[supplied by OMIM, Nov 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000241463
  • ENSP00000241463
  • ENSG00000122035
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.73
interacting protein
0.71
gene perturbation
0.62
transcription factor binding site profile
0.61
protein domain
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.45   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 26   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.45   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 26   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (6)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (24)
1 – 10 of 24
ARHGEF17
Tbio
Novelty: 0.04042956
p_int: 0.999708817
p_ni: 0.000291183
Data Source: BioPlex
ARL9
Tdark
Family: Enzyme
Novelty: 2.625
Score: 0.904
Data Source: STRINGDB
ARL10
Tdark
Family: Enzyme
Novelty: 2.4
Score: 0.8
Data Source: STRINGDB
KNCN
Tdark
Novelty: 0.33333333
Score: 0.696
Data Source: STRINGDB
C7orf57
Tdark
Novelty: 3.6
Score: 0.591
Data Source: STRINGDB
FAM222A
Tdark
Score: 0.563
Data Source: STRINGDB
PPP1R32
Tdark
Family: Enzyme
Novelty: 0.4
Score: 0.555
Data Source: STRINGDB
DUSP15
Tbio
Family: Enzyme
Novelty: 0.07899337
Score: 0.538
Data Source: STRINGDB
NKIRAS2
Tdark
Family: Enzyme
Novelty: 0.20963219
Score: 0.527
Data Source: STRINGDB
FAM111B
Tbio
Novelty: 0.0702439
Score: 0.497
Data Source: STRINGDB
Publication Statistics
PubMed Score  1.45

PubMed score by year
PubTator Score  1

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRPLSMSGHFLLAPIPESSSDYLLPKDIKLAVLGAGRVGKSAMIVRFLTKRFIGDYEPNTGKLYSRLVYV
1-70
EGDQLSLQIQDTPGGVQIQDSLPQVVDSLSKCVQWAEGFLLVYSITDYDSYLSIRPLYQHIRKVHPDSKA
70-140
PVIIVGNKGDLLHARQVQTQDGIQLANELGSLFLEISTSENYEDVCDVFQHLCKEVSKMHGLSGERRRAS
140-210
IIPRPRSPNMQDLKRRFKQALSPKVKAPSALG
210-242
MRPLSMSGHFLLAPIPESSSDYLLPKDIKLAVLGAGRVGKSAMIVRFLTKRFIGDYEPNTGKLYSRLVYVEGDQLSLQIQDTPGGVQIQDSLPQVVDSLSKCVQWAEGFLLVYSITDYDSYLSIRPLYQHIRKVHPDSKAPVIIVGNKGDLLHARQVQTQDGIQLANELGSLFLEISTSENYEDVCDVFQHLCKEVSKMHGLSGERRRASIIPRPRSPNMQDLKRRFKQALSPKVKAPSALG