You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SLC30A9
Zinc transporter 9

Protein Summary
Description
Acts as a zinc transporter involved in intracellular zinc homeostasis (PubMed:28334855). Functions as a secondary coactivator for nuclear receptors by cooperating with p160 coactivators subtypes. Plays a role in transcriptional activation of Wnt-responsive genes (By similarity).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000264451
  • ENSP00000264451
  • ENSG00000014824

Symbol
  • C4orf1
  • HUEL
  • HUEL
  • ZNT9
  • GAC63
  • C4orf1
  • BILAPES
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.9
histone modification site profile
0.85
interacting protein
0.85
transcription factor perturbation
0.84
kinase perturbation
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.66   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 142   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.66   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 142   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (15)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence Model (ISM)
NTNU_SB
Non-traceable Author Statement (NAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (60)
1 – 10 of 60
COX4I1
Tbio
Family: Enzyme
Novelty: 0.00416656
p_int: 0.999609431
p_ni: 0.000390569
Data Source: BioPlex
COX5A
Tbio
Family: Enzyme
Novelty: 0.00062551
p_int: 0.995319715
p_ni: 0.004680285
Score: 0.309
Data Source: BioPlex,STRINGDB
VNN2
Tbio
Novelty: 0.02727863
p_int: 0.971228463
p_ni: 0.028771536
p_wrong: 1e-9
Score: 0.212
Data Source: BioPlex,STRINGDB
TBC1D15
Tbio
Novelty: 0.2389305
p_int: 0.959127347
p_ni: 0.040872653
Score: 0.225
Data Source: BioPlex,STRINGDB
ERGIC3
Tbio
Novelty: 0.15783642
p_int: 0.955891698
p_ni: 0.044108302
Data Source: BioPlex
HLA-DQA1
Tbio
Novelty: 0.00059149
p_int: 0.806324905
p_ni: 0.193675095
Score: 0.187
Data Source: BioPlex,STRINGDB
HLA-DRA
Tbio
Novelty: 0.00705028
p_int: 0.759393474
p_ni: 0.240606526
Data Source: BioPlex
SLC30A6
Tbio
Family: Transporter
Novelty: 0.09437965
Score: 0.865
Data Source: STRINGDB
SLC30A5
Tbio
Family: Transporter
Novelty: 0.03895139
Score: 0.865
Data Source: STRINGDB
SLC30A7
Tbio
Family: Transporter
Novelty: 0.04211849
Score: 0.861
Data Source: STRINGDB
Publication Statistics
PubMed Score  10.66

PubMed score by year
PubTator Score  6.9

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLPGLAAAAAHRCSWSSLCRLRLRCRAAACNPSDRQEWQNLVTFGSFSNMVPCSHPYIGTLSQVKLYSTN
1-70
VQKEGQGSQTLRVEKVPSFETAEGIGTELKAPLKQEPLQVRVKAVLKKREYGSKYTQNNFITGVRAINEF
70-140
CLKSSDLEQLRKIRRRSPHEDTESFTVYLRSDVEAKSLEVWGSPEALAREKKLRKEAEIEYRERLFRNQK
140-210
ILREYRDFLGNTKPRSRTASVFFKGPGKVVMVAICINGLNCFFKFLAWIYTGSASMFSEAIHSLSDTCNQ
210-280
GLLALGISKSVQTPDPSHPYGFSNMRYISSLISGVGIFMMGAGLSWYHGVMGLLHPQPIESLLWAYCILA
280-350
GSLVSEGATLLVAVNELRRNARAKGMSFYKYVMESRDPSTNVILLEDTAAVLGVIIAATCMGLTSITGNP
350-420
LYDSLGSLGVGTLLGMVSAFLIYTNTEALLGRSIQPEQVQRLTELLENDPSVRAIHDVKATDLGLGKVRF
420-490
KAEVDFDGRVVTRSYLEKQDFDQMLQEIQEVKTPEELETFMLKHGENIIDTLGAEVDRLEKELKKRNPEV
490-560
RHVDLEIL
560-568
MLPGLAAAAAHRCSWSSLCRLRLRCRAAACNPSDRQEWQNLVTFGSFSNMVPCSHPYIGTLSQVKLYSTNVQKEGQGSQTLRVEKVPSFETAEGIGTELKAPLKQEPLQVRVKAVLKKREYGSKYTQNNFITGVRAINEFCLKSSDLEQLRKIRRRSPHEDTESFTVYLRSDVEAKSLEVWGSPEALAREKKLRKEAEIEYRERLFRNQKILREYRDFLGNTKPRSRTASVFFKGPGKVVMVAICINGLNCFFKFLAWIYTGSASMFSEAIHSLSDTCNQGLLALGISKSVQTPDPSHPYGFSNMRYISSLISGVGIFMMGAGLSWYHGVMGLLHPQPIESLLWAYCILAGSLVSEGATLLVAVNELRRNARAKGMSFYKYVMESRDPSTNVILLEDTAAVLGVIIAATCMGLTSITGNPLYDSLGSLGVGTLLGMVSAFLIYTNTEALLGRSIQPEQVQRLTELLENDPSVRAIHDVKATDLGLGKVRFKAEVDFDGRVVTRSYLEKQDFDQMLQEIQEVKTPEELETFMLKHGENIIDTLGAEVDRLEKELKKRNPEVRHVDLEIL