You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
CNST
Consortin

Protein Summary
Description
Required for targeting of connexins to the plasma membrane. Targeting of numerous transmembrane proteins to the cell surface is thought to depend on their recognition by cargo receptors that interact with the adaptor machinery for anterograde traffic at the distal end of the Golgi complex. Consortin (CNST) is an integral membrane protein that acts as a binding partner of connexins, the building blocks of gap junctions, and acts as a trans-Golgi network (TGN) receptor involved in connexin targeting to the plasma membrane and recycling from the cell surface (del Castillo et al., 2010 [PubMed 19864490]).[supplied by OMIM, Jun 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000366512
  • ENSP00000355469
  • ENSG00000162852
  • ENST00000366513
  • ENSP00000355470

Symbol
  • C1orf71
  • C1orf71
  • PPP1R64
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.94
transcription factor binding site profile
0.89
tissue sample
0.76
histone modification site profile
0.73
microRNA
0.71


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 62.05   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 16   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 62.05   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 16   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (11)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Protein-Protein Interactions (16)
1 – 10 of 16
PPP1CC
Tchem
Family: Enzyme
Novelty: 0.00538884
p_int: 0.999999946
p_ni: 4e-9
p_wrong: 5e-8
Score: 0.668
Data Source: BioPlex,STRINGDB
PPP1CA
Tchem
Family: Enzyme
Novelty: 0.00685545
p_int: 0.99998679
p_ni: 1.4e-8
p_wrong: 0.000013197
Score: 0.644
Data Source: BioPlex,STRINGDB
GJC1
Tbio
Novelty: 0.00506104
Score: 0.823
Data Source: STRINGDB
GJB6
Tbio
Novelty: 0.00160827
Score: 0.785
Data Source: STRINGDB
GGA2
Tbio
Novelty: 0.02058906
Score: 0.783
Data Source: STRINGDB
GJB1
Tbio
Novelty: 0.00115116
Score: 0.771
Data Source: STRINGDB
GJB2
Tbio
Novelty: 0.00063266
Score: 0.741
Data Source: STRINGDB
GGA1
Tbio
Novelty: 0.01230282
Score: 0.716
Data Source: STRINGDB
GJA1
Tbio
Novelty: 0.00023576
Score: 0.712
Data Source: STRINGDB
LRP3
Tbio
Novelty: 0.1489802
Score: 0.682
Data Source: STRINGDB
Publication Statistics
PubMed Score  62.05

PubMed score by year
PubTator Score  5.83

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDDSDTPTYYLQIEPQDGCHPGDSVERSVTCLPSASDENENQLDGDGHEHLTSSDSAMGKPQVSEQDSLN
1-70
NNESCTLSCEVAAGENLQNTLCEASRDEQAFLGKDKKIPGKRSPRSKKGTAKKIPPGLFSGDIAPLMQEK
70-140
VLSAVTYAVDDEEAAEVNANEQPEAPKLVLQSLFSLIRGEVEQLDSRALPLCLHQIAESYFQEEDYEKAM
140-210
KFIQLERLYHEQLLANLSAIQEQWETKWKTVQPHTVTALRNSEKGFNGEDFERLTKICATHQDPLLSKHK
210-280
IAAVEKSQERKCSTQLLVSEDPKEGGATTKESESKTCLGTESSKESQHTVEPLGSSPCCHQMDVQTDSPS
280-350
LSVTAGKDHMEELLCSAEATLALHTQSSETAGSPSGPDSSEDACEDDSRLQLAQTEACQDVARIEGIAED
350-420
PKVFLSSKSKTEPLISPGCDRIPPALISEGKYSQAQRKELRLPLRDASEALPTDQLENNELNELQQPDLT
420-490
DSDGKSPQAQADSDGSENVLCGNNQISDLGILLPEVCMAPEEKGDKDDQLNKETEDYLNSLLEGCLKDTE
490-560
DSLSYEDNQDDDSDLLQDLSPEEASYSLQENLPSDESCLSLDDLAKRIEIAEVVPTEGLVSILKKRNDTV
560-630
GDHPAQMQHKPSKRRVRFQEIDDSLDQDEVGGGSCILLVLLCIATVFLSVGGTALYCTFGDMESPVCTDF
630-700
ADNMDFYYTKLLQGVAELKHWIYLS
700-725
MDDSDTPTYYLQIEPQDGCHPGDSVERSVTCLPSASDENENQLDGDGHEHLTSSDSAMGKPQVSEQDSLNNNESCTLSCEVAAGENLQNTLCEASRDEQAFLGKDKKIPGKRSPRSKKGTAKKIPPGLFSGDIAPLMQEKVLSAVTYAVDDEEAAEVNANEQPEAPKLVLQSLFSLIRGEVEQLDSRALPLCLHQIAESYFQEEDYEKAMKFIQLERLYHEQLLANLSAIQEQWETKWKTVQPHTVTALRNSEKGFNGEDFERLTKICATHQDPLLSKHKIAAVEKSQERKCSTQLLVSEDPKEGGATTKESESKTCLGTESSKESQHTVEPLGSSPCCHQMDVQTDSPSLSVTAGKDHMEELLCSAEATLALHTQSSETAGSPSGPDSSEDACEDDSRLQLAQTEACQDVARIEGIAEDPKVFLSSKSKTEPLISPGCDRIPPALISEGKYSQAQRKELRLPLRDASEALPTDQLENNELNELQQPDLTDSDGKSPQAQADSDGSENVLCGNNQISDLGILLPEVCMAPEEKGDKDDQLNKETEDYLNSLLEGCLKDTEDSLSYEDNQDDDSDLLQDLSPEEASYSLQENLPSDESCLSLDDLAKRIEIAEVVPTEGLVSILKKRNDTVGDHPAQMQHKPSKRRVRFQEIDDSLDQDEVGGGSCILLVLLCIATVFLSVGGTALYCTFGDMESPVCTDFADNMDFYYTKLLQGVAELKHWIYLS