You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
IYD
Iodotyrosine deiodinase 1

Protein Summary
Description
Catalyzes the oxidative NADPH-dependent deiodination of monoiodotyrosine (L-MIT) or diiodotyrosine (L-DIT) (PubMed:15289438, PubMed:25395621, PubMed:18434651). Acts during the hydrolysis of thyroglobulin to liberate iodide, which can then reenter the hormone-producing pathways (PubMed:18434651). Acts more efficiently on monoiodotyrosine than on diiodotyrosine (PubMed:15289438). This gene encodes an enzyme that catalyzes the oxidative NADPH-dependent deiodination of mono- and diiodotyrosine, which are the halogenated byproducts of thyroid hormone production. The N-terminus of the protein functions as a membrane anchor. Mutations in this gene cause congenital hypothyroidism due to dyshormonogenesis type 4, which is also referred to as deiodinase deficiency, or iodotyrosine dehalogenase deficiency, or thyroid hormonogenesis type 4. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000229447
  • ENSP00000229447
  • ENSG00000009765
  • ENST00000344419
  • ENSP00000343763
  • ENST00000367335
  • ENSP00000356304
  • ENST00000392256
  • ENSP00000376085

Symbol
  • C6orf71
  • DEHAL1
  • TDH4
  • IYD-1
  • DEHAL1
  • C6orf71
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
1
virus perturbation
0.64
cell type or tissue
0.61
chemical
0.49
tissue sample
0.46


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 36.31   (req: < 5)
Gene RIFs: 10   (req: <= 3)
Antibodies: 60   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 36.31   (req: >= 5)
Gene RIFs: 10   (req: > 3)
Antibodies: 60   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (5)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Metabolism of amine-derived hormones
Reactome
Metabolism of amino acids and derivatives
Reactome
Thyroxine biosynthesis
Name
Explore in Pharos
Explore in Source
Metabolism
Metabolism of amine-derived hormones
Metabolism of amino acids and derivatives
Thyroxine biosynthesis
Gene Ontology Terms (11)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (44)
1 – 10 of 44
DDRGK1
Tbio
Novelty: 0.10926955
p_int: 0.803854365
p_ni: 0.196145635
Score: 0.277
Data Source: BioPlex,STRINGDB
SLC5A5
Tbio
Family: Transporter
Novelty: 0.00116643
Score: 0.755
Data Source: STRINGDB
DUOXA2
Tbio
Family: Enzyme
Novelty: 0.04086646
Score: 0.742
Data Source: STRINGDB
DUOX2
Tchem
Family: Enzyme
Novelty: 0.00313172
Score: 0.714
Data Source: STRINGDB
TRIM69
Tbio
Family: Enzyme
Novelty: 0.19062537
Score: 0.667
Data Source: STRINGDB
SLC26A4
Tbio
Family: Transporter
Novelty: 0.00186048
Score: 0.665
Data Source: STRINGDB
TG
Tbio
Novelty: 0.00012413
Score: 0.65
Data Source: STRINGDB
BLVRB
Tbio
Family: Enzyme
Novelty: 0.00428818
Score: 0.644
Data Source: STRINGDB
C1orf158
Tdark
Score: 0.63
Data Source: STRINGDB
TPO
Tclin
Family: Enzyme
Novelty: 0.0016197
Score: 0.598
Data Source: STRINGDB
Publication Statistics
PubMed Score  36.31

PubMed score by year
PubTator Score  23.76

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MYFLTPILVAILCILVVWIFKNADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEEN
1-70
VEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVV
70-140
KDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVH
140-210
YYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVLLGRPAHEKLLMLLPVGYPSKEATVPDLKRK
210-280
PLDQIMVTV
280-289
MYFLTPILVAILCILVVWIFKNADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENVEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVLLGRPAHEKLLMLLPVGYPSKEATVPDLKRKPLDQIMVTV