You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RFWD3
E3 ubiquitin-protein ligase RFWD3

Protein Summary
Description
E3 ubiquitin-protein ligase required for the repair of DNA interstrand cross-links (ICL) in response to DNA damage (PubMed:21504906, PubMed:21558276, PubMed:26474068, PubMed:28575657, PubMed:28575658). Plays a key role in RPA-mediated DNA damage signaling and repair (PubMed:21504906, PubMed:21558276, PubMed:26474068, PubMed:28575657, PubMed:28575658, PubMed:28691929). Acts by mediating ubiquitination of the RPA complex (RPA1, RPA2 and RPA3 subunits) and RAD51 at stalled replication forks, leading to remove them from DNA damage sites and promote homologous recombination (PubMed:26474068, PubMed:28575657, PubMed:28575658). Also mediates the ubiquitination of p53/TP53 in the late response to DNA damage, and acts as a positive regulator of p53/TP53 stability, thereby regulating the G1/S DNA damage checkpoint (PubMed:20173098). May act by catalyzing the formation of short polyubiquitin chains on p53/TP53 that are not targeted to the proteasome (PubMed:20173098). In response to ionizing radi ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000361070
  • ENSP00000354361
  • ENSG00000168411
  • ENST00000571750
  • ENSP00000460049

Symbol
  • RNF201
  • FANCW
  • RNF201
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.91
histone modification site profile
0.85
virus perturbation
0.85
microRNA
0.76
protein domain
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 8.64   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 100   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 8.64   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 100   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (52)
Items per page:
1 – 1 of 1
Data Source
Name
Explore in Pharos
Explore in Source
UniProt
Protein modification; protein ubiquitination.
Name
Explore in Pharos
Explore in Source
Protein modification; protein ubiquitination.
Protein-Protein Interactions (48)
1 – 10 of 48
CEP170
Tbio
Novelty: 0.00614876
p_int: 0.9999972
p_ni: 0.0000028
Data Source: BioPlex
CCT2
Tbio
Novelty: 0.03021537
p_int: 0.999992686
p_ni: 0.000007314
Data Source: BioPlex
DISC1
Tbio
Novelty: 0.00165188
p_int: 0.999914404
p_ni: 0.000079606
p_wrong: 0.00000599
Data Source: BioPlex
EPB41L3
Tbio
Novelty: 0.00828944
p_int: 0.999842571
p_ni: 0.000157416
p_wrong: 1.3e-8
Data Source: BioPlex
CCT7
Tbio
Novelty: 0.03353089
p_int: 0.999796575
p_ni: 0.000203424
p_wrong: 1e-9
Data Source: BioPlex
PIP4K2A
Tbio
Family: Kinase
Novelty: 0.01482796
p_int: 0.999213222
p_ni: 0.000546776
p_wrong: 0.000240002
Data Source: BioPlex
MBIP
Tbio
Novelty: 0.10438201
p_int: 0.999183081
p_ni: 0.000816919
Data Source: BioPlex
DNAJB2
Tbio
Novelty: 0.06294878
p_int: 0.997995444
p_ni: 0.002004551
p_wrong: 5e-9
Score: 0.191
Data Source: BioPlex,STRINGDB
CCT5
Tbio
Novelty: 0.02957327
p_int: 0.997782222
p_ni: 0.002217618
p_wrong: 1.6e-7
Data Source: BioPlex
BBS7
Tbio
Novelty: 0.06755563
p_int: 0.990276509
p_ni: 0.007266879
p_wrong: 0.002456612
Data Source: BioPlex
Publication Statistics
PubMed Score  8.64

PubMed score by year
PubTator Score  4.16

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAHEAMEYDVQVQLNHAEQQPAPAGMASSQGGPALLQPVPADVVSSQGVPSILQPAPAEVISSQATPPLL
1-70
QPAPQLSVDLTEVEVLGEDTVENINPRTSEQHRQGSDGNHTIPASSLHSMTNFISGLQRLHGMLEFLRPS
70-140
SSNHSVGPMRTRRRVSASRRARAGGSQRTDSARLRAPLDAYFQVSRTQPDLPATTYDSETRNPVSEELQV
140-210
SSSSDSDSDSSAEYGGVVDQAEESGAVILEEQLAGVSAEQEVTCIDGGKTLPKQPSPQKSEPLLPSASMD
210-280
EEEGDTCTICLEQWTNAGDHRLSALRCGHLFGYRCISTWLKGQVRKCPQCNKKARHSDIVVLYARTLRAL
280-350
DTSEQERMKSSLLKEQMLRKQAELESAQCRLQLQVLTDKCTRLQRRVQDLQKLTSHQSQNLQQPRGSQAW
350-420
VLSCSPSSQGQHKHKYHFQKTFTVSQAGNCRIMAYCDALSCLVISQPSPQASFLPGFGVKMLSTANMKSS
420-490
QYIPMHGKQIRGLAFSSYLRGLLLSASLDNTIKLTSLETNTVVQTYNAGRPVWSCCWCLDEANYIYAGLA
490-560
NGSILVYDVRNTSSHVQELVAQKARCPLVSLSYMPRAASAAFPYGGVLAGTLEDASFWEQKMDFSHWPHV
560-630
LPLEPGGCIDFQTENSSRHCLVTYRPDKNHTTIRSVLMEMSYRLDDTGNPICSCQPVHTFFGGPTCKLLT
630-700
KNAIFQSPENDGNILVCTGDEAANSALLWDAASGSLLQDLQTDQPVLDICPFEVNRNSYLATLTEKMVHI
700-770
YKWE
770-774
MAHEAMEYDVQVQLNHAEQQPAPAGMASSQGGPALLQPVPADVVSSQGVPSILQPAPAEVISSQATPPLLQPAPQLSVDLTEVEVLGEDTVENINPRTSEQHRQGSDGNHTIPASSLHSMTNFISGLQRLHGMLEFLRPSSSNHSVGPMRTRRRVSASRRARAGGSQRTDSARLRAPLDAYFQVSRTQPDLPATTYDSETRNPVSEELQVSSSSDSDSDSSAEYGGVVDQAEESGAVILEEQLAGVSAEQEVTCIDGGKTLPKQPSPQKSEPLLPSASMDEEEGDTCTICLEQWTNAGDHRLSALRCGHLFGYRCISTWLKGQVRKCPQCNKKARHSDIVVLYARTLRALDTSEQERMKSSLLKEQMLRKQAELESAQCRLQLQVLTDKCTRLQRRVQDLQKLTSHQSQNLQQPRGSQAWVLSCSPSSQGQHKHKYHFQKTFTVSQAGNCRIMAYCDALSCLVISQPSPQASFLPGFGVKMLSTANMKSSQYIPMHGKQIRGLAFSSYLRGLLLSASLDNTIKLTSLETNTVVQTYNAGRPVWSCCWCLDEANYIYAGLANGSILVYDVRNTSSHVQELVAQKARCPLVSLSYMPRAASAAFPYGGVLAGTLEDASFWEQKMDFSHWPHVLPLEPGGCIDFQTENSSRHCLVTYRPDKNHTTIRSVLMEMSYRLDDTGNPICSCQPVHTFFGGPTCKLLTKNAIFQSPENDGNILVCTGDEAANSALLWDAASGSLLQDLQTDQPVLDICPFEVNRNSYLATLTEKMVHIYKWE