You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
SLC27A1
Long-chain fatty acid transport protein 1

Protein Summary
Description
Mediates the ATP-dependent import of long-chain fatty acids (LCFA) into the cell by mediating their translocation at the plasma membrane (PubMed:28178239). Has also an acyl-CoA ligase activity for long-chain and very-long-chain fatty acids. May act directly as a bona fide transporter, or alternatively, in a cytoplasmic or membrane-associated multimeric protein complex to trap and draw fatty acids towards accumulation. Plays a pivotal role in regulating available LCFA substrates from exogenous sources in tissues undergoing high levels of beta-oxidation or triglyceride synthesis. May be involved in regulation of cholesterol metabolism (By similarity).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000252595
  • ENSP00000252595
  • ENSG00000130304
  • ENST00000598424
  • ENSP00000472313

Symbol
  • ACSVL5
  • FATP1
  • FATP
  • FATP1
  • ACSVL5
  • FATP-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
metabolite
1
biological process
0.94
histone modification site profile
0.83
molecular function
0.73
kinase perturbation
0.71


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 166.77   (req: < 5)
Gene RIFs: 12   (req: <= 3)
Antibodies: 135   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 166.77   (req: >= 5)
Gene RIFs: 12   (req: > 3)
Antibodies: 135   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 24
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 31
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (31)
1 – 10 of 31
CHEMBL2058359
chemical structure image
CHEMBL2377765,CHEMBL2377766
chemical structure image
CHEMBL2377619,CHEMBL2377610
chemical structure image
CHEMBL2377621
chemical structure image
CHEMBL2377617,CHEMBL2377611
chemical structure image
CHEMBL2377767
chemical structure image
CHEMBL2057220
chemical structure image
CHEMBL2377622
chemical structure image
CHEMBL2058339
chemical structure image
CHEMBL2058078
chemical structure image
Pathways (32)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
PPARA activates gene expression
Reactome
Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha)
Reactome
SLC-mediated transmembrane transport
Name
Explore in Pharos
Explore in Source
Metabolism
Metabolism of lipids
PPARA activates gene expression
Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha)
SLC-mediated transmembrane transport
Gene Ontology Terms (30)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (85)
1 – 10 of 85
FABP1
Tchem
Novelty: 0.002508
Score: 0.961
Data Source: STRINGDB
PPARA
Tclin
Family: NR
Novelty: 0.00026802
Score: 0.946
Data Source: STRINGDB
RXRA
Tclin
Family: NR
Novelty: 0.00314166
Score: 0.917
Data Source: STRINGDB
NCOA1
Tchem
Family: Epigenetic
Novelty: 0.00427551
Score: 0.914
Data Source: STRINGDB
CHD9
Tbio
Family: Epigenetic
Novelty: 0.10573131
Score: 0.912
Data Source: STRINGDB
SMARCD3
Tbio
Novelty: 0.04645544
Score: 0.904
Data Source: STRINGDB
CARM1
Tchem
Family: Epigenetic
Novelty: 0.0078817
Score: 0.903
Data Source: STRINGDB
NCOA6
Tbio
Novelty: 0.01482918
Score: 0.902
Data Source: STRINGDB
TBL1X
Tbio
Novelty: 0.0021757
Score: 0.9
Data Source: STRINGDB
TGS1
Tbio
Family: Enzyme
Novelty: 0.04
Score: 0.9
Data Source: STRINGDB
Publication Statistics
PubMed Score  166.77

PubMed score by year
PubTator Score  85.09

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRAPGAGAASVVSLALLWLLGLPWTWSAAAALGVYVGSGGWRFLRIVCKTARRDLFGLSVLIRVRLELRR
1-70
HQRAGHTIPRIFQAVVQRQPERLALVDAGTGECWTFAQLDAYSNAVANLFRQLGFAPGDVVAIFLEGRPE
70-140
FVGLWLGLAKAGMEAALLNVNLRREPLAFCLGTSGAKALIFGGEMVAAVAEVSGHLGKSLIKFCSGDLGP
140-210
EGILPDTHLLDPLLKEASTAPLAQIPSKGMDDRLFYIYTSGTTGLPKAAIVVHSRYYRMAAFGHHAYRMQ
210-280
AADVLYDCLPLYHSAGNIIGVGQCLIYGLTVVLRKKFSASRFWDDCIKYNCTVVQYIGEICRYLLKQPVR
280-350
EAERRHRVRLAVGNGLRPAIWEEFTERFGVRQIGEFYGATECNCSIANMDGKVGSCGFNSRILPHVYPIR
350-420
LVKVNEDTMELLRDAQGLCIPCQAGEPGLLVGQINQQDPLRRFDGYVSESATSKKIAHSVFSKGDSAYLS
420-490
GDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEGVLSRLLGQTDVAVYGVAVPGVEGKAGMAAVADPH
490-560
SLLDPNAIYQELQKVLAPYARPIFLRLLPQVDTTGTFKIQKTRLQREGFDPRQTSDRLFFLDLKQGHYLP
560-630
LNEAVYTRICSGAFAL
630-646
MRAPGAGAASVVSLALLWLLGLPWTWSAAAALGVYVGSGGWRFLRIVCKTARRDLFGLSVLIRVRLELRRHQRAGHTIPRIFQAVVQRQPERLALVDAGTGECWTFAQLDAYSNAVANLFRQLGFAPGDVVAIFLEGRPEFVGLWLGLAKAGMEAALLNVNLRREPLAFCLGTSGAKALIFGGEMVAAVAEVSGHLGKSLIKFCSGDLGPEGILPDTHLLDPLLKEASTAPLAQIPSKGMDDRLFYIYTSGTTGLPKAAIVVHSRYYRMAAFGHHAYRMQAADVLYDCLPLYHSAGNIIGVGQCLIYGLTVVLRKKFSASRFWDDCIKYNCTVVQYIGEICRYLLKQPVREAERRHRVRLAVGNGLRPAIWEEFTERFGVRQIGEFYGATECNCSIANMDGKVGSCGFNSRILPHVYPIRLVKVNEDTMELLRDAQGLCIPCQAGEPGLLVGQINQQDPLRRFDGYVSESATSKKIAHSVFSKGDSAYLSGDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEGVLSRLLGQTDVAVYGVAVPGVEGKAGMAAVADPHSLLDPNAIYQELQKVLAPYARPIFLRLLPQVDTTGTFKIQKTRLQREGFDPRQTSDRLFFLDLKQGHYLPLNEAVYTRICSGAFAL