You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
NOTUM
Palmitoleoyl-protein carboxylesterase NOTUM

Protein Summary
Description
Carboxylesterase that acts as a key negative regulator of the Wnt signaling pathway by specifically mediating depalmitoleoylation of WNT proteins. Serine palmitoleoylation of WNT proteins is required for efficient binding to frizzled receptors (PubMed:25731175).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000409678
  • ENSP00000387310
  • ENSG00000185269

Symbol
  • hNOTUM
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.78
kinase perturbation
0.76
transcription factor binding site profile
0.74
PubMedID
0.6
transcription factor
0.59


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 165.52   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 156   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 165.52   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 156   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 63
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (12)
1 – 5 of 12
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (75)
Hedgehog ligand biogenesis (R-HSA-5358346)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Hedgehog ligand biogenesis
Reactome
Metabolism of proteins
Reactome
Post-translational protein modification
Reactome
Post-translational protein phosphorylation
Reactome
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Name
Explore in Pharos
Explore in Source
Hedgehog ligand biogenesis
Metabolism of proteins
Post-translational protein modification
Post-translational protein phosphorylation
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Protein-Protein Interactions (167)
1 – 10 of 167
GPC3
Tbio
Novelty: 0.00107694
Score: 0.976
Data Source: STRINGDB
WNT1
Tbio
Novelty: 0.0015436
Score: 0.966
Data Source: STRINGDB
GPC5
Tbio
Novelty: 0.01709985
Score: 0.962
Data Source: Reactome,STRINGDB
SHH
Tchem
Novelty: 0.00033539
Score: 0.938
Data Source: Reactome,STRINGDB
BMP4
Tchem
Novelty: 0.00057391
Score: 0.937
Data Source: STRINGDB
AHSG
Tbio
Novelty: 0.00097441
Score: 0.932
Data Source: STRINGDB
ALB
Tchem
Novelty: 0.0000092
Score: 0.932
Data Source: STRINGDB
IHH
Tbio
Novelty: 0.00230273
Score: 0.928
Data Source: STRINGDB
AFP
Tbio
Novelty: 0.00006259
Score: 0.928
Data Source: STRINGDB
DHH
Tbio
Novelty: 0.00436048
Score: 0.927
Data Source: STRINGDB
Publication Statistics
PubMed Score  165.52

PubMed score by year
PubTator Score  8.58

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGRGVRVLLLLSLLHCAGGSEGRKTWRRRGQQPPPPPRTEAAPAAGQPVESFPLDFTAVEGNMDSFMAQV
1-70
KSLAQSLYPCSAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGWYCFNRENCDSRY
70-140
DTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQE
140-210
VVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCV
210-280
DTITCAPTEAIRRGIRYWNGVVPERCRRQFQEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTVDNVH
280-350
LTGQPVQEGLRLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLHD
350-420
SHKASKTPLKGCPVHLVDSCPWPHCNPSCPTVRDQFTGQEMNVAQFLMHMGFDMQTVAQPQGLEPSELLG
420-490
MLSNGS
490-496
MGRGVRVLLLLSLLHCAGGSEGRKTWRRRGQQPPPPPRTEAAPAAGQPVESFPLDFTAVEGNMDSFMAQVKSLAQSLYPCSAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGWYCFNRENCDSRYDTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGIRYWNGVVPERCRRQFQEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTVDNVHLTGQPVQEGLRLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLHDSHKASKTPLKGCPVHLVDSCPWPHCNPSCPTVRDQFTGQEMNVAQFLMHMGFDMQTVAQPQGLEPSELLGMLSNGS