You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
C22orf39
UPF0545 protein C22orf39

IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.13   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 9   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.13   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 9   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (5)
Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
22q11.2 Deletion Syndrome
WikiPathways
22q11.2 Deletion Syndrome
WikiPathways
22q11.2 Deletion Syndrome
WikiPathways
22q11.2 Deletion Syndrome
WikiPathways
Fragile X Syndrome
Name
Explore in Pharos
Explore in Source
22q11.2 Deletion Syndrome
22q11.2 Deletion Syndrome
22q11.2 Deletion Syndrome
22q11.2 Deletion Syndrome
Fragile X Syndrome
Protein-Protein Interactions (19)
1 – 10 of 19
TIMM8A
Tbio
Family: Enzyme
Novelty: 0.00261956
p_int: 0.999987182
p_ni: 0.000004612
p_wrong: 0.000008206
Data Source: BioPlex
ATP23
Tbio
Family: Enzyme
Novelty: 0.13977877
p_int: 0.99996885
p_ni: 0.000001031
p_wrong: 0.000030119
Data Source: BioPlex
ECM1
Tbio
Novelty: 0.00696614
p_int: 0.995790801
p_ni: 7.14e-7
p_wrong: 0.004208484
Data Source: BioPlex
TRIM74
Tdark
Novelty: 5
Score: 0.659
Data Source: STRINGDB
TRIM73
Tdark
Novelty: 1.11111111
Score: 0.641
Data Source: STRINGDB
ANKRD36
Tdark
Novelty: 1.10032362
Score: 0.553
Data Source: STRINGDB
ZNF74
Tbio
Family: TF
Novelty: 0.14162077
Score: 0.511
Data Source: STRINGDB
MRPS33
Tdark
Novelty: 0.4
Score: 0.507
Data Source: STRINGDB
TRIM50
Tbio
Family: Enzyme
Novelty: 0.25641026
Score: 0.493
Data Source: STRINGDB
NRROS
Tbio
Novelty: 0.15009747
Score: 0.491
Data Source: STRINGDB
Publication Statistics
PubMed Score  0.13

PubMed score by year
Amino Acid Sequence
Residue Counts
Sequence
MCRCSLVLLSVDHEVPFSSFFIGWRTEGRAWRAGRPDMADGSGWQPPRPCEAYRAEWKLCRSARHFLHHY
1-70
YVHGERPACEQWQRDLASCRDWEERRNAEAQQSLCESERARVRAARKHILVWAPRQSPPPDWHLPLPQEK
70-140
DE
140-142
MCRCSLVLLSVDHEVPFSSFFIGWRTEGRAWRAGRPDMADGSGWQPPRPCEAYRAEWKLCRSARHFLHHYYVHGERPACEQWQRDLASCRDWEERRNAEAQQSLCESERARVRAARKHILVWAPRQSPPPDWHLPLPQEKDE