You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
MZT2A
Mitotic-spindle organizing protein 2A

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000309451
  • ENSP00000311500
  • ENSG00000173272

Symbol
  • FAM128A
  • MOZART2A
  • FAM128A
  • MOZART2A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.98
histone modification site profile
0.9
cell type or tissue
0.89
transcription factor perturbation
0.74
tissue sample
0.64


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.11   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 3   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.11   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 3   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (9)
Cell Cycle (R-HSA-1640170)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell Cycle
Reactome
Cell Cycle, Mitotic
Reactome
Centrosome maturation
Reactome
G2/M Transition
Reactome
M Phase
Name
Explore in Pharos
Explore in Source
Cell Cycle
Cell Cycle, Mitotic
Centrosome maturation
G2/M Transition
M Phase
Gene Ontology Terms (5)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
HPA
Inferred from Direct Assay (IDA)
HPA
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Protein-Protein Interactions (90)
1 – 10 of 90
TUBG2
Tbio
Novelty: 0.23300971
p_int: 0.99999982
p_ni: 7.9e-8
p_wrong: 1.01e-7
Score: 0.978
Data Source: BioPlex,STRINGDB
MZT1
Tdark
Novelty: 0.14016352
p_int: 0.999998418
p_ni: 2.95e-7
p_wrong: 0.000001288
Score: 0.997
Data Source: BioPlex,STRINGDB
LGALS3BP
Tbio
Novelty: 0.00116733
p_int: 0.999969925
p_ni: 0.000002469
p_wrong: 0.000027606
Score: 0.597
Data Source: BioPlex,STRINGDB
TXNDC12
Tbio
Novelty: 0.02131718
p_int: 0.999929875
p_ni: 0.000002088
p_wrong: 0.000068037
Score: 0.818
Data Source: BioPlex,STRINGDB
TUBGCP5
Tbio
Novelty: 0.12782794
p_int: 0.99984909
p_ni: 4.7e-8
p_wrong: 0.000150863
Score: 0.996
Data Source: BioPlex,STRINGDB
TUBGCP4
Tbio
Novelty: 0.01120518
Score: 0.991
Data Source: STRINGDB
TUBG1
Tbio
Novelty: 0.03880643
Score: 0.98
Data Source: STRINGDB
NME7
Tbio
Family: Enzyme
Novelty: 0.11051019
Score: 0.973
Data Source: STRINGDB
NEDD1
Tbio
Novelty: 0.03704684
Score: 0.97
Data Source: STRINGDB
TUBGCP2
Tbio
Novelty: 0.03216604
Score: 0.97
Data Source: STRINGDB
Publication Statistics
PubMed Score  0.11

PubMed score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGGIDPDVFKILVDLLKLNVAPL
1-70
AVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRDKGSAALGGVLALAERSNHEGSSQRMPRQPSA
70-140
TRLPKGGGPGKSPTQGST
140-158
MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGGIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRDKGSAALGGVLALAERSNHEGSSQRMPRQPSATRLPKGGGPGKSPTQGST