You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
C1orf94
Uncharacterized protein C1orf94

IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 45   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 45   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (10)
1 – 10 of 10
HERC4
Tbio
Family: Enzyme
Novelty: 0.08485706
p_int: 0.999990639
p_ni: 0.000009361
Score: 0.188
Data Source: BioPlex,STRINGDB
NIF3L1
Tbio
Novelty: 0.21052632
p_int: 0.99967922
p_ni: 0.00032078
Score: 0.169
Data Source: BioPlex,STRINGDB
MMADHC
Tbio
Novelty: 0.03382644
p_int: 0.999460308
p_ni: 0.000490969
p_wrong: 0.000048723
Score: 0.19
Data Source: BioPlex,STRINGDB
ANKRD40
Tdark
p_int: 0.999456143
p_ni: 0.000543856
p_wrong: 1e-9
Score: 0.183
Data Source: BioPlex,STRINGDB
USO1
Tbio
Novelty: 0.0073839
p_int: 0.996533672
p_ni: 0.003466328
Score: 0.169
Data Source: BioPlex,STRINGDB
RPAP1
Tdark
Family: Enzyme
Novelty: 0.46511628
p_int: 0.995760807
p_ni: 0.004239193
Score: 0.199
Data Source: BioPlex,STRINGDB
GLUL
Tchem
Family: Enzyme
Novelty: 0.00112575
p_int: 0.838068305
p_ni: 0.161931695
Score: 0.187
Data Source: BioPlex,STRINGDB
HSPA8
Tchem
Novelty: 0.00100906
p_int: 0.803964839
p_ni: 0.196035161
Data Source: BioPlex
CARM1
Tchem
Family: Epigenetic
Novelty: 0.0078817
p_int: 0.803829864
p_ni: 0.196170136
Data Source: BioPlex
RFX2
Tbio
Family: TF
Novelty: 0.05597812
Score: 0.48
Data Source: STRINGDB
Publication Statistics
Amino Acid Sequence
Residue Counts
Sequence
MRGGGGCVLALGGQRGFQKERRRMASGNGLPSSSALVAKGPCALGPFPRYIWIHQDTPQDSLDKTCHEIW
1-70
KRVQGLPEASQPWTSMEQLSVPVVGTLRGNELSFQEEALELSSGKDEISLLVEQEFLSLTKEHSILVEES
70-140
SGELEVPGSSPEGTRELAPCILAPPLVAGSNERPRASIIVGDKLLKQKVAMPVISSRQDCDSATSTVTDI
140-210
LCAAEVKSSKGTEDRGRILGDSNLQVSKLLSQFPLKSTETSKVPDNKNVLDKTRVTKDFLQDNLFSGPGP
210-280
KEPTGLSPFLLLPPRPPPARPDKLPELPAQKRQLPVFAKICSKPKADPAVERHHLMEWSPGTKEPKKGQG
280-350
SLFLSQWPQSQKDACGEEGCCDAVGTASLTLPPKKPTCPAEKNLLYEFLGATKNPSGQPRLRNKVEVDGP
350-420
ELKFNAPVTVADKNNPKYTGNVFTPHFPTAMTSATLNQPLWLNLNYPPPPVFTNHSTFLQYQGLYPQQAA
420-490
RMPYQQALHPQLGCYSQQVMPYNPQQMGQQIFRSSYTPLLSYIPFVQPNYPYPQRTPPKMSANPRDPPLM
490-560
AGDGPQYLFPQGYGFGSTSGGPLMHSPYFSSSGNGINF
560-598
MRGGGGCVLALGGQRGFQKERRRMASGNGLPSSSALVAKGPCALGPFPRYIWIHQDTPQDSLDKTCHEIWKRVQGLPEASQPWTSMEQLSVPVVGTLRGNELSFQEEALELSSGKDEISLLVEQEFLSLTKEHSILVEESSGELEVPGSSPEGTRELAPCILAPPLVAGSNERPRASIIVGDKLLKQKVAMPVISSRQDCDSATSTVTDILCAAEVKSSKGTEDRGRILGDSNLQVSKLLSQFPLKSTETSKVPDNKNVLDKTRVTKDFLQDNLFSGPGPKEPTGLSPFLLLPPRPPPARPDKLPELPAQKRQLPVFAKICSKPKADPAVERHHLMEWSPGTKEPKKGQGSLFLSQWPQSQKDACGEEGCCDAVGTASLTLPPKKPTCPAEKNLLYEFLGATKNPSGQPRLRNKVEVDGPELKFNAPVTVADKNNPKYTGNVFTPHFPTAMTSATLNQPLWLNLNYPPPPVFTNHSTFLQYQGLYPQQAARMPYQQALHPQLGCYSQQVMPYNPQQMGQQIFRSSYTPLLSYIPFVQPNYPYPQRTPPKMSANPRDPPLMAGDGPQYLFPQGYGFGSTSGGPLMHSPYFSSSGNGINF