You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
SLC27A4
Long-chain fatty acid transport protein 4

Protein Summary
Description
Involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. Appears to be the principal fatty acid transporter in small intestinal enterocytes. Plays a role in the formation of the epidermal barrier. Required for fat absorption in early embryogenesis. Has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids (VLCFAs). Indirectly inhibits RPE65 via substrate competition and via production of VLCFA derivatives like lignoceroyl-CoA. Prevents light-induced degeneration of rods and cones (By similarity). This gene encodes a member of a family of fatty acid transport proteins, which are involved in translocation of long-chain fatty acids cross the plasma membrane. This protein is expressed at high levels on the apical side of mature enterocytes in the small intestine, and appears to be the principal fatty acid transporter in enterocytes. Clinical studies suggest this gene as a candidate gene for the insulin resistance syndrome. Mutations in this g ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000300456
  • ENSP00000300456
  • ENSG00000167114
  • ENST00000372870
  • ENSP00000361961

Symbol
  • ACSVL4
  • FATP4
  • IPS
  • FATP4
  • ACSVL4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.9
cellular component
0.81
protein domain
0.73
transcription factor perturbation
0.68
cell line
0.64


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 53.85   (req: < 5)
Gene RIFs: 22   (req: <= 3)
Antibodies: 133   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 53.85   (req: >= 5)
Gene RIFs: 22   (req: > 3)
Antibodies: 133   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 14
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (14)
1 – 10 of 14
CHEMBL209855
chemical structure image
CHEMBL426323
chemical structure image
CHEMBL437303
chemical structure image
CHEMBL211864
chemical structure image
CHEMBL211941
chemical structure image
CHEMBL211612
chemical structure image
CHEMBL211772
chemical structure image
CHEMBL211117
chemical structure image
CHEMBL212012
chemical structure image
CHEMBL378290
chemical structure image
Pathways (16)
Defective SLC27A4 causes ichthyosis prematurity syndrome (IPS) (R-HSA-5619108)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Defective SLC27A4 causes ichthyosis prematurity syndrome (IPS)
Reactome
Disease
Reactome
Disorders of transmembrane transporters
Reactome
SLC transporter disorders
Reactome
SLC-mediated transmembrane transport
Name
Explore in Pharos
Explore in Source
Defective SLC27A4 causes ichthyosis prematurity syndrome (IPS)
Disease
Disorders of transmembrane transporters
SLC transporter disorders
SLC-mediated transmembrane transport
Gene Ontology Terms (20)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (60)
1 – 10 of 60
LRBA
Tbio
Novelty: 0.00096206
p_int: 0.99221591
p_ni: 0.00778409
Data Source: BioPlex
RDH13
Tdark
Family: Enzyme
Novelty: 0.30784266
p_int: 0.974596487
p_ni: 0.02535168
p_wrong: 0.000051834
Data Source: BioPlex
FSD2
Tdark
Novelty: 0.20182853
p_int: 0.930818145
p_ni: 0.069181855
Data Source: BioPlex
SLC27A1
Tchem
Family: Transporter
Novelty: 0.00568795
Score: 0.812
Data Source: STRINGDB
NIPAL4
Tbio
Novelty: 0.04908645
Score: 0.708
Data Source: STRINGDB
CD36
Tbio
Novelty: 0.00216049
Score: 0.69
Data Source: STRINGDB
ACSL1
Tbio
Family: Enzyme
Novelty: 0.00272619
Score: 0.675
Data Source: STRINGDB
ACSL5
Tbio
Family: Enzyme
Novelty: 0.0104023
Score: 0.671
Data Source: STRINGDB
RPL23
Tbio
Novelty: 0.02634055
Score: 0.623
Data Source: STRINGDB
FABP1
Tchem
Novelty: 0.002508
Score: 0.614
Data Source: STRINGDB
Publication Statistics
PubMed Score  53.85

PubMed score by year
PubTator Score  45.25

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLLGASLVGVLLFSKLVLKLPWTQVGFSLLFLYLGSGGWRFIRVFIKTIRRDIFGGLVLLKVKAKVRQCL
1-70
QERRTVPILFASTVRRHPDKTALIFEGTDTHWTFRQLDEYSSSVANFLQARGLASGDVAAIFMENRNEFV
70-140
GLWLGMAKLGVEAALINTNLRRDALLHCLTTSRARALVFGSEMASAICEVHASLDPSLSLFCSGSWEPGA
140-210
VPPSTEHLDPLLKDAPKHLPSCPDKGFTDKLFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGFRMRPND
210-280
IVYDCLPLYHSAGNIVGIGQCLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYLLNQPPREAE
280-350
NQHQVRMALGNGLRQSIWTNFSSRFHIPQVAEFYGATECNCSLGNFDSQVGACGFNSRILSFVYPIRLVR
350-420
VNEDTMELIRGPDGVCIPCQPGEPGQLVGRIIQKDPLRRFDGYLNQGANNKKIAKDVFKKGDQAYLTGDV
420-490
LVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEGRAGMAAVASPTGNC
490-560
DLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQ
560-630
EAYSRIQAGEEKL
630-643
MLLGASLVGVLLFSKLVLKLPWTQVGFSLLFLYLGSGGWRFIRVFIKTIRRDIFGGLVLLKVKAKVRQCLQERRTVPILFASTVRRHPDKTALIFEGTDTHWTFRQLDEYSSSVANFLQARGLASGDVAAIFMENRNEFVGLWLGMAKLGVEAALINTNLRRDALLHCLTTSRARALVFGSEMASAICEVHASLDPSLSLFCSGSWEPGAVPPSTEHLDPLLKDAPKHLPSCPDKGFTDKLFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGFRMRPNDIVYDCLPLYHSAGNIVGIGQCLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYLLNQPPREAENQHQVRMALGNGLRQSIWTNFSSRFHIPQVAEFYGATECNCSLGNFDSQVGACGFNSRILSFVYPIRLVRVNEDTMELIRGPDGVCIPCQPGEPGQLVGRIIQKDPLRRFDGYLNQGANNKKIAKDVFKKGDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL