You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
KIAA1841
Uncharacterized protein KIAA1841

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000295031
  • ENSP00000295031
  • ENSG00000162929
  • ENST00000356719
  • ENSP00000349154
  • ENST00000402291
  • ENSP00000385579
  • ENST00000453873
  • ENSP00000416795
  • ENST00000612149
  • ENSP00000482126
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.9
tissue sample
0.7
gene perturbation
0.63
cell type or tissue
0.61
transcription factor
0.59


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.07   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 52   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.07   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 52   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (32)
1 – 10 of 32
NICN1
Tdark
Novelty: 0.60606061
p_int: 0.999998982
p_ni: 3e-8
p_wrong: 9.88e-7
Score: 0.829
Data Source: BioPlex,STRINGDB
LRRC49
Tdark
Novelty: 0.23026316
p_int: 0.999998146
p_ni: 4e-8
p_wrong: 0.000001814
Score: 0.851
Data Source: BioPlex,STRINGDB
TTLL1
Tdark
Family: Enzyme
Novelty: 0.14944557
p_int: 0.896314335
p_ni: 0.000090129
p_wrong: 0.103595536
Score: 0.874
Data Source: BioPlex,STRINGDB
C2orf74
Tdark
Novelty: 0.79808328
Score: 0.86
Data Source: STRINGDB
SIRPD
Tdark
Novelty: 15
Score: 0.585
Data Source: STRINGDB
AHSA2P
Tdark
Family: Enzyme
Novelty: 0.69709544
Score: 0.58
Data Source: STRINGDB
ZNF680
Tdark
Family: TF
Score: 0.567
Data Source: STRINGDB
FAM162B
Tdark
Novelty: 3.15789474
Score: 0.53
Data Source: STRINGDB
ZUP1
Tbio
Family: Enzyme
Novelty: 0.25641026
Score: 0.511
Data Source: STRINGDB
ZNF117
Tdark
Family: TF
Novelty: 0.91666667
Score: 0.483
Data Source: STRINGDB
Publication Statistics
PubMed Score  0.07

PubMed score by year
PubTator Score  0.07

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSRGYSENNNFLNNNNQMVLDMILYPLIGIPQTINWETIARLVPGLTPKECAKRFDELKSSGSSPVDNQY
1-70
NSLMAAGESPVETLATYIKSSLLDIHGEFQETPVGHDAVSKTGRHSIASTRNCSSESENCTTHNGGEMTE
70-140
ESEGPNMVIHVCDEAKNLKEDFTCPRDLLISEMKYFAEYLSMDAQRWEEVDISVHCDVHIFNWLIKYIKR
140-210
NTKENKDCEMPTLEPGNVISILISSEFLKMDSLVEQCIQYCHKNMNAIVATPCNMNCINANLLTRIADLF
210-280
SHNEVDDLKDKKDKFKSKLFCKKIERLFDPEYLNPDSRSNAATLYRCCLCKKLLTKETERRIPCIPGKIN
280-350
VDRRGNIVYIHIRDKTWDVHEYLNSLFEELKSWRDVYWRLWGTINWLTCSRCYQAFLCIEFSHCQYHSET
350-420
VVYPTAASSLNTVGTGIYPCCNQKVLRFDPTQLTKGCKVRDHMVTLRDQGEGGDLPSCPTARMLDDLHKY
420-490
RDVIVVPFSKDTVSDVGVGLCDEKGIECDVLLEPNTPWGPKTGELNAFLSLKNWTLQLKQQSLFSEEEEY
490-560
TTGSEVTEDEVGDEEEVSKKQRKKEKPKKFTRQPKKQVSSPCAQRKEKALEKSASRDVSPFVMSMQKNKW
560-630
DATRSLRFNQDAQREDDQRRMTEITGHLIKMRLGDLDRVKSKEAKEFAGGIYSRLEAQIKASVPVSARQS
630-700
SSEKNTRSKSRFGQGRPA
700-718
MSRGYSENNNFLNNNNQMVLDMILYPLIGIPQTINWETIARLVPGLTPKECAKRFDELKSSGSSPVDNQYNSLMAAGESPVETLATYIKSSLLDIHGEFQETPVGHDAVSKTGRHSIASTRNCSSESENCTTHNGGEMTEESEGPNMVIHVCDEAKNLKEDFTCPRDLLISEMKYFAEYLSMDAQRWEEVDISVHCDVHIFNWLIKYIKRNTKENKDCEMPTLEPGNVISILISSEFLKMDSLVEQCIQYCHKNMNAIVATPCNMNCINANLLTRIADLFSHNEVDDLKDKKDKFKSKLFCKKIERLFDPEYLNPDSRSNAATLYRCCLCKKLLTKETERRIPCIPGKINVDRRGNIVYIHIRDKTWDVHEYLNSLFEELKSWRDVYWRLWGTINWLTCSRCYQAFLCIEFSHCQYHSETVVYPTAASSLNTVGTGIYPCCNQKVLRFDPTQLTKGCKVRDHMVTLRDQGEGGDLPSCPTARMLDDLHKYRDVIVVPFSKDTVSDVGVGLCDEKGIECDVLLEPNTPWGPKTGELNAFLSLKNWTLQLKQQSLFSEEEEYTTGSEVTEDEVGDEEEVSKKQRKKEKPKKFTRQPKKQVSSPCAQRKEKALEKSASRDVSPFVMSMQKNKWDATRSLRFNQDAQREDDQRRMTEITGHLIKMRLGDLDRVKSKEAKEFAGGIYSRLEAQIKASVPVSARQSSSEKNTRSKSRFGQGRPA